Nakaseomyces glabratus: 9487983 Help Entry 9487983           CDS       T01024                                  Symbol RBX1, GVI51_E01331 Name (RefSeq) RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cgr  Nakaseomyces glabratus Pathway cgr03420   Nucleotide excision repair cgr04111   Cell cycle - yeast cgr04120   Ubiquitin mediated proteolysis cgr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     9487983 (RBX1)    04120 Ubiquitin mediated proteolysis     9487983 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     9487983 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     9487983 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cgr04121]     9487983 (RBX1)    03400 DNA repair and recombination proteins [BR:cgr03400]     9487983 (RBX1) Enzymes [BR:cgr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      9487983 (RBX1) Ubiquitin system [BR:cgr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    9487983 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      9487983 (RBX1)    Cul2 complex      9487983 (RBX1)    Cul3 complex      9487983 (RBX1)    Cul4 complex      9487983 (RBX1)    Cul7 complex      9487983 (RBX1)    Cul8 complex      9487983 (RBX1)    Cul9 complex      9487983 (RBX1) DNA repair and recombination proteins [BR:cgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       9487983 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       9487983 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-C3HC4_4 PHD_NSD Motif Other DBs NCBI-GeneID:  9487983 NCBI-ProteinID:  XP_002999535 UniProt:  B4UMZ3 LinkDB All DBs Position E:163335..163643 Genome browser AA seq 102 aa AA seqDB search MDQMEVDSEEVPKKKFQIKKWTAVAFWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDN ECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQPWHLARCGR NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggaccagatggaagtggactccgaggaagttcccaagaagaagtttcagatcaagaag tggactgctgttgctttctggtcgtgggacatagctgtggataactgtgcgatctgtagg aaccacatcatggaaccgtgtatagagtgtcagccgaaggcaatgactgatacagataac gaatgtgtggccgcgtggggtacgtgtaaccacgccttccatttacactgtataaacaag tggattaagacgagagatgcctgtccgctagataaccagccttggcacttagccaggtgt gggaggtag

DBGET integrated database retrieval system