Clupea harengus (Atlantic herring): 105889074 Help Entry 105889074         CDS       T09045                                  Symbol cd59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism char  Clupea harengus (Atlantic herring) Brite KEGG Orthology (KO) [BR:char00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     105889074 (cd59)    04090 CD molecules [BR:char04090]     105889074 (cd59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:char00537]     105889074 (cd59) Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105889074 (cd59)   Exosomal proteins of other body fluids (saliva and urine)    105889074 (cd59)   Exosomal proteins of colorectal cancer cells    105889074 (cd59) CD molecules [BR:char04090]  Proteins   105889074 (cd59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:char00537]  Antigens   105889074 (cd59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  105889074 NCBI-ProteinID:  XP_012670287 Ensembl:  ENSCHAG00000001627 UniProt:  A0A6P3VER3 LinkDB All DBs Position 6:25881317..25884313 Genome browser AA seq 118 aa AA seqDB search MKTSVGICLVFLLAIFGLGSALQCYKCKDYTGSCTKVRSCGWEDACLTLKERGGQIYRQC IKYDDCDYNRLSQMFPSVSSFTYRCCSNDLCNAAPITAAGKPLMGLVASLALFWWCIL NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgaaaacatctgttggaatttgccttgttttcctccttgcgatatttggacttggctct gcactccagtgctacaaatgtaaagactacactgggagctgcaccaaggtccgtagctgt ggctgggaggatgcgtgcctcacactgaaggagagaggtggccaaatataccgccagtgc atcaagtacgatgactgtgattacaaccggctctcccagatgttcccttcagtgtccagc ttcacatacaggtgctgcagcaatgacctgtgcaacgcagcccccatcactgctgctggc aagcctctgatgggcctggtggcgtccctggccctcttctggtggtgcatcttgtaa

DBGET integrated database retrieval system