Clupea harengus (Atlantic herring): 105889759 Help Entry 105889759         CDS       T09045                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism char  Clupea harengus (Atlantic herring) Pathway char04010   MAPK signaling pathway char04012   ErbB signaling pathway char04068   FoxO signaling pathway char04137   Mitophagy - animal char04140   Autophagy - animal char04150   mTOR signaling pathway char04210   Apoptosis char04218   Cellular senescence char04370   VEGF signaling pathway char04371   Apelin signaling pathway char04540   Gap junction char04625   C-type lectin receptor signaling pathway char04810   Regulation of actin cytoskeleton char04910   Insulin signaling pathway char04912   GnRH signaling pathway char04916   Melanogenesis Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105889759 (nras)    04012 ErbB signaling pathway     105889759 (nras)    04370 VEGF signaling pathway     105889759 (nras)    04371 Apelin signaling pathway     105889759 (nras)    04068 FoxO signaling pathway     105889759 (nras)    04150 mTOR signaling pathway     105889759 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105889759 (nras)    04137 Mitophagy - animal     105889759 (nras)   09143 Cell growth and death    04210 Apoptosis     105889759 (nras)    04218 Cellular senescence     105889759 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     105889759 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105889759 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105889759 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     105889759 (nras)    04912 GnRH signaling pathway     105889759 (nras)    04916 Melanogenesis     105889759 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:char04131]     105889759 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     105889759 (nras)    04031 GTP-binding proteins [BR:char04031]     105889759 (nras) Membrane trafficking [BR:char04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105889759 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     105889759 (nras) Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105889759 (nras)   Exosomal proteins of other body fluids (saliva and urine)    105889759 (nras)   Exosomal proteins of breast cancer cells    105889759 (nras)   Exosomal proteins of colorectal cancer cells    105889759 (nras) GTP-binding proteins [BR:char04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105889759 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  105889759 NCBI-ProteinID:  XP_012671135 Ensembl:  ENSCHAG00000020193 UniProt:  A0A6P3VGS8 LinkDB All DBs Position 4:complement(5678609..5684087) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGISCAVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataaattagtggtggttggtgcaggcggtgttggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgagtacgatccgaccatcgaggattcgtac aggaagcaggtggtgattgatggcgagacgtgtctgctggacatcctggacacagcaggg caggaggagtacagcgccatgagggaccagtacatgaggactggcgaaggttttctctgc gtcttcgccatcaacaacagcaaatcttttgctgatgtgcatctctacagagaacagatc aagagggttaaggactctgatgatgttcctatggtactagtgggtaataaatgtgatctg gctagaactgtagacacaaagcaggcacaggaacttgccagaagctacggcatcgagttt gttgaaacctctgccaagaccagacagggagtggaagatgccttctacacactggttcga gaaatccgccactaccgcatgaaaaagctcaacagcagagaggaccgtaaacagggctgc ctgggcatctcctgtgccgtcatgtga

DBGET integrated database retrieval system