Clupea harengus (Atlantic herring): 105890192 Help Entry 105890192         CDS       T09045                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism char  Clupea harengus (Atlantic herring) Pathway char04140   Autophagy - animal char04150   mTOR signaling pathway char04218   Cellular senescence char04910   Insulin signaling pathway char05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     105890192 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105890192 (rheb)   09143 Cell growth and death    04218 Cellular senescence     105890192 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105890192 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     105890192 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:char04031]     105890192 (rheb) GTP-binding proteins [BR:char04031]  Small (monomeric) G-proteins   Ras Family    Rheb     105890192 (rheb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase RhoGAP_pG1_pG2 YebF ParE_toxin Reovirus_M2 AAA_14 Motif Other DBs NCBI-GeneID:  105890192 NCBI-ProteinID:  XP_012671619 Ensembl:  ENSCHAG00000018839 UniProt:  A0A6P3VHA2 LinkDB All DBs Position 17:complement(898556..918026) Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAVLGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVKVIHEKLLDMVGKVQVPIMLVGNK KDLHMERVISCEEGKALAESWNAAFMESSAKENQTAVEVFKRIILEAEKIEGGAPQGRTS CSLM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgaaatcccgaaaaattgctgttctgggatacagatccgttgggaagtcc tctttgacaatacagtttgtggaaggccagtttgtggactcttatgacccaaccatagaa aacacatttacaaaaatgatcacagtcaatggtcaggagtaccatctgcagttggtcgac acagcaggccaggacgaatactcaatcttcccacagacctactccatagacatcaatggt tacattttggtgtattctgttacgtcaaataaaagttttgaagtagtaaaagttatccac gaaaagctgttggatatggtgggaaaagtacaagtaccaataatgttggtgggaaacaag aaagatcttcacatggaacgtgttatcagctgtgaagagggcaaagccctggcagagtca tggaacgctgcgttcatggagtcctcggcgaaagagaaccagactgcagtggaggtcttt aaaaggataatcctggaggcagagaagatcgagggcggcgccccacaaggaaggacatcc tgctccctgatgtag

DBGET integrated database retrieval system