Clupea harengus (Atlantic herring): 105892655 Help Entry 105892655         CDS       T09045                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism char  Clupea harengus (Atlantic herring) Pathway char04010   MAPK signaling pathway char04012   ErbB signaling pathway char04068   FoxO signaling pathway char04137   Mitophagy - animal char04140   Autophagy - animal char04144   Endocytosis char04150   mTOR signaling pathway char04210   Apoptosis char04218   Cellular senescence char04370   VEGF signaling pathway char04371   Apelin signaling pathway char04510   Focal adhesion char04540   Gap junction char04625   C-type lectin receptor signaling pathway char04810   Regulation of actin cytoskeleton char04910   Insulin signaling pathway char04912   GnRH signaling pathway char04916   Melanogenesis char05132   Salmonella infection Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105892655    04012 ErbB signaling pathway     105892655    04370 VEGF signaling pathway     105892655    04371 Apelin signaling pathway     105892655    04068 FoxO signaling pathway     105892655    04150 mTOR signaling pathway     105892655  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105892655    04140 Autophagy - animal     105892655    04137 Mitophagy - animal     105892655   09143 Cell growth and death    04210 Apoptosis     105892655    04218 Cellular senescence     105892655   09144 Cellular community - eukaryotes    04510 Focal adhesion     105892655    04540 Gap junction     105892655   09142 Cell motility    04810 Regulation of actin cytoskeleton     105892655  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105892655   09152 Endocrine system    04910 Insulin signaling pathway     105892655    04912 GnRH signaling pathway     105892655    04916 Melanogenesis     105892655  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105892655  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:char04131]     105892655   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     105892655    04031 GTP-binding proteins [BR:char04031]     105892655 Membrane trafficking [BR:char04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105892655  Endocytosis   Macropinocytosis    Ras GTPases     105892655 Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105892655   Exosomal proteins of colorectal cancer cells    105892655 GTP-binding proteins [BR:char04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105892655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Motif Other DBs NCBI-GeneID:  105892655 NCBI-ProteinID:  XP_012674412 Ensembl:  ENSCHAG00000005068 UniProt:  A0A6P3VK73 LinkDB All DBs Position 6:14447504..14457724 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD CFKCRCVLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagctggtggtggttggggcaggtggtgtgggcaaaagtgcactcacc attcaactcattcagaatcactttgttgatgaatatgatcccactattgaggactcttac agaaagcaggtggtgattgacggggagacgtgcctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggaccggcgagggttttctgtgt gtgtttgccatcaacaacaccaagtcctttgaggacatccaccagtacagggagcagata aagcgggtgaaggactcagacgatgtgcccatggtgcttgtgggcaataagtgtgacctg ccatcgcgcacagtggacacgcgtcaggcccaggagctcgcccgcagctatggcatccct tacatcgagacctctgccaagacccgacagggagtggaagacgccttttacaccctggtg agagagatcaggcagcacaaactgaggaagctcaacccgcctgatgacaacggacaggac tgcttcaagtgtcgctgtgtattgtcatga

DBGET integrated database retrieval system