Clupea harengus (Atlantic herring): 105894046 Help Entry 105894046         CDS       T09045                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism char  Clupea harengus (Atlantic herring) Pathway char04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:char00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105894046  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:char04121]     105894046    03400 DNA repair and recombination proteins [BR:char03400]     105894046 Ubiquitin system [BR:char04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      105894046    Cul5 complex      105894046 DNA repair and recombination proteins [BR:char03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105894046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  105894046 NCBI-ProteinID:  XP_012675972 Ensembl:  ENSCHAG00000004160 UniProt:  A0A6P3VMJ3 LinkDB All DBs Position 23:21180474..21186389 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKATIFTDAKESTTVYELKRIVEGILKRTPEDQRLFKDEQLLDDSKTLGDY GYTNQTARPQAPATVGLAFRLTGDTFEPLQVEPFSSPPELPDVMKPQDSGSTANEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtctttttaatgatccggcgtcacaaggcgacaattttcactgacgccaaggag tccacgaccgtgtacgagctcaaacgtatcgtggaggggatcctgaagagaacccccgaa gaccagagacttttcaaggatgaacagctgctggatgacagtaagactctgggtgactac ggctacaccaaccagactgctcgtccacaggctcccgctactgttggactagccttccgc ctcaccggcgacacctttgagcccctgcaggtggagcccttctccagtcctccagagctc ccagacgtcatgaagccccaggactccggcagcaccgccaacgagcagtccgtgcagtga

DBGET integrated database retrieval system