Clupea harengus (Atlantic herring): 105895801 Help Entry 105895801         CDS       T09045                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism char  Clupea harengus (Atlantic herring) Pathway char03082   ATP-dependent chromatin remodeling char04217   Necroptosis Brite KEGG Orthology (KO) [BR:char00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105895801  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105895801  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:char03036]     105895801   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     105895801 Chromosome and associated proteins [BR:char03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105895801 Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105895801 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  105895801 NCBI-ProteinID:  XP_012677944 UniProt:  A0A6P3VRL3 LinkDB All DBs Position 24:9376527..9376942 Genome browser AA seq 125 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKSRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKSK NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgagcggcagaggtaaaaccggaggaaaggctagagctaaggccaagactcgctcttcc agggctggactacagttccccgtgggccgtgttcacaggctgctccgcaagggcaactat gcccatcgtgttggcgctggtgctccggtgtacatggctgctgtactcgagtatcttact gctgagattctcgagttggccggcaacgctgcccgtgacaacaagaagagtcgtatcatt ccccgccatctgcagctggctgtgcgcaacgacgaggagttgaacaagctgctcggcgga gtgaccatcgctcagggtggtgtgctgcccaatatccaggctgtgctcctgcccaaaaag accgagaaatccaagtaa

DBGET integrated database retrieval system