Clupea harengus (Atlantic herring): 105895920 Help Entry 105895920         CDS       T09045                                  Name (RefSeq) calglandulin   KO K02183   calmodulin Organism char  Clupea harengus (Atlantic herring) Pathway char04020   Calcium signaling pathway char04070   Phosphatidylinositol signaling system char04114   Oocyte meiosis char04218   Cellular senescence char04261   Adrenergic signaling in cardiomyocytes char04270   Vascular smooth muscle contraction char04371   Apelin signaling pathway char04625   C-type lectin receptor signaling pathway char04744   Phototransduction char04910   Insulin signaling pathway char04912   GnRH signaling pathway char04916   Melanogenesis Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     105895920    04020 Calcium signaling pathway     105895920    04070 Phosphatidylinositol signaling system     105895920  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105895920    04218 Cellular senescence     105895920  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105895920   09152 Endocrine system    04910 Insulin signaling pathway     105895920    04912 GnRH signaling pathway     105895920    04916 Melanogenesis     105895920   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     105895920    04270 Vascular smooth muscle contraction     105895920   09157 Sensory system    04744 Phototransduction     105895920  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:char01009]     105895920   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:char04131]     105895920    03036 Chromosome and associated proteins [BR:char03036]     105895920   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     105895920 Protein phosphatases and associated proteins [BR:char01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105895920 Membrane trafficking [BR:char04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     105895920 Chromosome and associated proteins [BR:char03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      105895920 Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105895920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 AIF-1 EF-hand_8 EF-hand_9 EF-hand_5 EH EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  105895920 NCBI-ProteinID:  XP_012678067 Ensembl:  ENSCHAG00000020919 UniProt:  A0A6P3VQA4 LinkDB All DBs Position 5:25729582..25732254 Genome browser AA seq 155 aa AA seqDB search MANKLTPEQITEYKGVFEMFDEEGNGDVKTQELERLMSLMGINPTKRELGQMAKDVDKDG KGAFNCDSFLGLMALYLERTKNQDAELRAAFKVFDKDAKGYIDWNTLKYVLMNAGEPLNE LEAEQMMKEADKDGDGTIDYEEFVAMMTGDSFKMS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcaaacaagctgaccccagaacagatcacagagtataagggggtgtttgagatgttt gatgaggagggcaacggagatgtgaagacgcaggagctggagaggctaatgagtttgatg ggcatcaaccccactaagagagagcttggccagatggctaaagatgtggataaagatggc aaaggagctttcaactgcgacagcttcttgggattgatggccttatacctcgagaggacc aagaaccaggatgcagagctccgggctgccttcaaagtgtttgacaaagatgccaaaggc tatatcgactggaacacactgaagtatgtgctgatgaatgcaggagaacccctaaatgag ctagaggctgagcagatgatgaaagaggctgacaaagacggtgatggaaccattgattac gaagagtttgtggccatgatgacaggagactcgttcaagatgagttaa

DBGET integrated database retrieval system