Clupea harengus (Atlantic herring): 105897680 Help Entry 105897680         CDS       T09045                                  Symbol elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism char  Clupea harengus (Atlantic herring) Pathway char04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:char00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105897680 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:char04121]     105897680 (elob)    03400 DNA repair and recombination proteins [BR:char03400]     105897680 (elob) Ubiquitin system [BR:char04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      105897680 (elob)    Cul5 complex      105897680 (elob) DNA repair and recombination proteins [BR:char03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      105897680 (elob) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  105897680 NCBI-ProteinID:  XP_012680083 Ensembl:  ENSCHAG00000000015 UniProt:  A0A6P3VTL2 LinkDB All DBs Position 1:237749..241151 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDVLLDDSKTLGDC GFTNQTARPQAPGTVGLAFRANDETFEPLRVEPFSSPPELPDVMKPQDSSSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttccttatgatcaggcgtcacaagacgaccattttcacagacgcaaaagag tccaccactgtttatgaactgaaacgtatcgtggaaggcatcctgaaacgggctccagaa gagcagaggctttataaggatgatgtattgctggacgacagtaaaactcttggagattgt ggatttacaaaccagacagcgcggccccaggccccaggcactgttggactggcgttccgt gccaatgatgagacttttgaaccactgagggtggaacccttctccagccctcctgagcta ccggacgtcatgaagccccaagactccagcagcactgccaacgagcaggcggtgcagtga

DBGET integrated database retrieval system