Clupea harengus (Atlantic herring): 105898511 Help Entry 105898511         CDS       T09045                                  Name (RefSeq) insulin   KO K04526   insulin Organism char  Clupea harengus (Atlantic herring) Pathway char04010   MAPK signaling pathway char04068   FoxO signaling pathway char04081   Hormone signaling char04114   Oocyte meiosis char04140   Autophagy - animal char04150   mTOR signaling pathway char04810   Regulation of actin cytoskeleton char04910   Insulin signaling pathway char04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105898511    04068 FoxO signaling pathway     105898511    04150 mTOR signaling pathway     105898511   09133 Signaling molecules and interaction    04081 Hormone signaling     105898511  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105898511   09143 Cell growth and death    04114 Oocyte meiosis     105898511   09142 Cell motility    04810 Regulation of actin cytoskeleton     105898511  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105898511    04914 Progesterone-mediated oocyte maturation     105898511  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:char04052]     105898511 Cytokines and neuropeptides [BR:char04052]  Neuropeptides   Unclassified    105898511 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  105898511 NCBI-ProteinID:  XP_012681001 Ensembl:  ENSCHAG00000007134 UniProt:  A0A6P3VTL5 LinkDB All DBs Position 1:18891389..18892642 Genome browser AA seq 118 aa AA seqDB search MSGFRVLLLLLCCVSLAPSSPGTLAVSLRARRLCGVHLVDALLFVCGERGLFYQPGRRVR EEDIRIMMDSVPSLEETRVVLDKSRGGPSRVISKRGIVEQCCHFYCDFYDLENYCKNT NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtctggtttcagagtgctgttgctgctgctctgctgtgtgtctctggctcccagctcc cctggtacgctcgcagtctccctcagggctcgccgactgtgtggagttcacctggtggac gccctgctgtttgtctgcggcgagaggggactcttctaccagccgggaagacgtgtcaga gaggaagacatacgtatcatgatggacagtgttccttctcttgaggagaccagagttgtc ctggacaaaagcagaggaggacccagcagagtgatctcaaagaggggcattgttgagcag tgctgtcacttctactgtgacttctatgacctggagaattactgtaagaacacataa

DBGET integrated database retrieval system