Clupea harengus (Atlantic herring): 105902849 Help Entry 105902849         CDS       T09045                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism char  Clupea harengus (Atlantic herring) Pathway char04010   MAPK signaling pathway char04068   FoxO signaling pathway char04081   Hormone signaling char04114   Oocyte meiosis char04140   Autophagy - animal char04150   mTOR signaling pathway char04810   Regulation of actin cytoskeleton char04910   Insulin signaling pathway char04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105902849 (insb)    04068 FoxO signaling pathway     105902849 (insb)    04150 mTOR signaling pathway     105902849 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     105902849 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105902849 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     105902849 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105902849 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     105902849 (insb)    04914 Progesterone-mediated oocyte maturation     105902849 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:char04052]     105902849 (insb) Cytokines and neuropeptides [BR:char04052]  Neuropeptides   Unclassified    105902849 (insb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  105902849 NCBI-ProteinID:  XP_031443253 UniProt:  A0A6P8GXQ9 LinkDB All DBs Position 20:8158877..8159821 Genome browser AA seq 123 aa AA seqDB search MSKLLPQLSTAFRMARLPPAAPVVLLLLTSCFPRGLTAPPQYLCGSHLVEALYLVCGDNG FFYSPSKSKRDLAALLVLLSKSSVPGRQKHPVNVRMEVRMKRGIVEQCCHQPCSIYHLQD YCN NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgtccaaactacttccacagctatccacagcattccggatggcccgcctacccccagca gcccctgtggtgctgctgcttcttacttcctgtttcccacgaggcttgaccgctccgccc caatacctgtgtggctctcacctggtggaggctctgtacctggtgtgtggtgacaatggc ttcttctacagtcccagcaagagcaaaagggacctggcagctctcctggttctcctctcc aagtcatcagtcccggggagacagaagcatccggtgaacgtgcgcatggaggtgagaatg aagagaggcatagtagaacagtgttgccaccagccatgcagcatctaccacctgcaggac tactgcaactga

DBGET integrated database retrieval system