Clupea harengus (Atlantic herring): 105903955 Help Entry 105903955         CDS       T09045                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism char  Clupea harengus (Atlantic herring) Pathway char04060   Cytokine-cytokine receptor interaction char04218   Cellular senescence char04620   Toll-like receptor signaling pathway char04621   NOD-like receptor signaling pathway char04622   RIG-I-like receptor signaling pathway char05132   Salmonella infection Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105903955  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     105903955  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105903955    04621 NOD-like receptor signaling pathway     105903955    04622 RIG-I-like receptor signaling pathway     105903955  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105903955  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:char04052]     105903955    00536 Glycosaminoglycan binding proteins [BR:char00536]     105903955 Cytokines and neuropeptides [BR:char04052]  Cytokines   Chemokines    105903955 Glycosaminoglycan binding proteins [BR:char00536]  Heparan sulfate / Heparin   Chemokines    105903955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105903955 NCBI-ProteinID:  XP_031415834 Ensembl:  ENSCHAG00000022728 UniProt:  A0A6P8EUI7 LinkDB All DBs Position 22:5321857..5322727 Genome browser AA seq 95 aa AA seqDB search MSSKILGSFFTFLAACLVVTEGMSLRGAGVEPRCRCIGTESRRIGKLISRVELFSPNPHC KDTEIIATLKDSGEEICLDSSAPWVRKVIDKILSR NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagcagtaaaatacttggcagtttttttacttttcttgcggcctgtctggttgttaca gaaggtatgagcctgcgaggggcgggagtggagcctcgctgtcgctgcatcgggacagag agccggcggattgggaaactgatttcaagagtagaactgttctccccaaaccctcactgc aaagacacagagatcattgccacattgaaagatagtggtgaggagatttgcttggactcc agtgctccctgggttagaaaagtcattgacaaaatcttgtctaggtaa

DBGET integrated database retrieval system