Clupea harengus (Atlantic herring): 105905506 Help Entry 105905506         CDS       T09045                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism char  Clupea harengus (Atlantic herring) Pathway char04068   FoxO signaling pathway char04136   Autophagy - other char04140   Autophagy - animal char04621   NOD-like receptor signaling pathway char04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     105905506 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105905506 (atg12)    04136 Autophagy - other     105905506 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105905506 (atg12)    04622 RIG-I-like receptor signaling pathway     105905506 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:char04131]     105905506 (atg12)    04121 Ubiquitin system [BR:char04121]     105905506 (atg12)    03029 Mitochondrial biogenesis [BR:char03029]     105905506 (atg12) Membrane trafficking [BR:char04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     105905506 (atg12) Ubiquitin system [BR:char04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    105905506 (atg12) Mitochondrial biogenesis [BR:char03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     105905506 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  105905506 NCBI-ProteinID:  XP_012688966 Ensembl:  ENSCHAG00000017434 UniProt:  A0A6P3W5L7 LinkDB All DBs Position 11:complement(22692222..22694556) Genome browser AA seq 134 aa AA seqDB search MTKLHSSNAGTFAKMSDNADSPTESQKDDPPTQQPPTEDSGLVDEKKKIDVLLKAVGDTP IMKTKKWTVERGRTVHSLSQFISRFLKLEPSEQLFIYVNQSFAPSPDQEVGVLFESFGSD GKLVLHYCKSQAWG NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgacaaagctgcactcctccaacgcaggcacatttgcaaagatgtcagataatgctgac tctccaacagaatcacaaaaagatgatccgcctacacagcagcctccgactgaagactct ggacttgtagatgaaaagaaaaagattgatgtgttactaaaggctgttggagacactccc attatgaagaccaagaagtggactgtggagcgtggaagaacagtgcattctctttcacag tttatctcacgttttctaaagcttgagcctagtgaacaactgtttatatatgtcaatcag tcctttgcaccatcgcctgaccaagaagtaggtgtgctttttgagtctttcggcagtgat ggaaagttggttctacactactgtaaatcccaagcctggggctga

DBGET integrated database retrieval system