Clupea harengus (Atlantic herring): 105905971 Help Entry 105905971         CDS       T09045                                  Name (RefSeq) fibroblast growth factor 18-like   KO K04358   fibroblast growth factor Organism char  Clupea harengus (Atlantic herring) Pathway char04010   MAPK signaling pathway char04020   Calcium signaling pathway char04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105905971    04020 Calcium signaling pathway     105905971  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105905971  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:char04052]     105905971    00536 Glycosaminoglycan binding proteins [BR:char00536]     105905971 Cytokines and neuropeptides [BR:char04052]  Cytokines   Growth factors (RTK binding)    105905971 Glycosaminoglycan binding proteins [BR:char00536]  Heparan sulfate / Heparin   Growth factors/receptors    105905971 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  105905971 NCBI-ProteinID:  XP_031427181 UniProt:  A0A6P8FUP1 LinkDB All DBs Position 8:complement(11897378..11900500) Genome browser AA seq 123 aa AA seqDB search MRPLLSALLIMCFQALLVVCSPLQVLAVDNFNFSVHVENQTRLRDAMSRTYHRLYQLYSR TSGKHVQVLGKRISANGEDGDKYAQLIVEADTFGSQVRIRGKETNFYLCMNRRGKLIGKA SQL NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcggcccctgctctcagcgctgctcataatgtgtttccaggctttactggtagtttgc agccctcttcaggtgcttgccgttgacaacttcaacttcagcgtgcacgtggagaaccag acgcgtctgcgggacgccatgagccggacgtaccacaggctctaccagctgtacagcaga accagcggcaaacatgtccaggtcctgggaaaaaggatcagtgccaacggagaggatggg gacaaatatgcccagcttattgttgaagccgacacctttgggagtcaagtcagaattcgt gggaaggagaccaacttctacctgtgcatgaaccgcagagggaagctcattgggaaggca agtcaattgtaa

DBGET integrated database retrieval system