Clupea harengus (Atlantic herring): 105908082 Help Entry 105908082         CDS       T09045                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism char  Clupea harengus (Atlantic herring) Pathway char04081   Hormone signaling char04144   Endocytosis char04150   mTOR signaling pathway char04270   Vascular smooth muscle contraction char04310   Wnt signaling pathway char04350   TGF-beta signaling pathway char04510   Focal adhesion char04520   Adherens junction char04530   Tight junction char04621   NOD-like receptor signaling pathway char04625   C-type lectin receptor signaling pathway char04810   Regulation of actin cytoskeleton char05100   Bacterial invasion of epithelial cells char05132   Salmonella infection Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105908082 (rhoca)    04350 TGF-beta signaling pathway     105908082 (rhoca)    04150 mTOR signaling pathway     105908082 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     105908082 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105908082 (rhoca)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105908082 (rhoca)    04520 Adherens junction     105908082 (rhoca)    04530 Tight junction     105908082 (rhoca)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105908082 (rhoca)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105908082 (rhoca)    04625 C-type lectin receptor signaling pathway     105908082 (rhoca)   09153 Circulatory system    04270 Vascular smooth muscle contraction     105908082 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105908082 (rhoca)    05100 Bacterial invasion of epithelial cells     105908082 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:char04131]     105908082 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     105908082 (rhoca)    04031 GTP-binding proteins [BR:char04031]     105908082 (rhoca) Membrane trafficking [BR:char04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     105908082 (rhoca) Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105908082 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    105908082 (rhoca)   Exosomal proteins of colorectal cancer cells    105908082 (rhoca)   Exosomal proteins of bladder cancer cells    105908082 (rhoca) GTP-binding proteins [BR:char04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     105908082 (rhoca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  105908082 NCBI-ProteinID:  XP_012692005 Ensembl:  ENSCHAG00000011323 UniProt:  A0A6P3W811 LinkDB All DBs Position 5:11388503..11413397 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVRDVFEMATRAALQ VRKRKKRSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaagttggtgatcgtgggtgatggagcgtgtggaaagacctgt ctcctcatcgtcttcagcaaggaccagttcccagaggtgtacgtgcccaccgtctttgag aactacatcgctgacatcgaagtggatggcaagcaggtggagctggcgttgtgggataca gcaggacaggaagactatgacaggctgaggcccctctcctaccccgatacagacgtcatc ctcatgtgcttctccattgacagccctgacagtttagagaatattccggagaagtggact cctgaggtgaagcacttctgccccaacgtccccatcatcctcgtggggaacaagaaggac ctgaggaacgacgagcacacgcgacgggagctggccaagatgaaacaggagccggtgaag ccagaggagggccgggatatggccaaccgcatcagcgccttcggctacctggagtgctcg gccaagaccaaggatggcgtgcgtgacgtcttcgagatggccacaagggcggcgctgcag gtgcgcaagcgcaagaagaggagtggatgcctcctgttgtga

DBGET integrated database retrieval system