Clupea harengus (Atlantic herring): 105911212 Help Entry 105911212         CDS       T09045                                  Symbol pfn4 Name (RefSeq) profilin-4   KO K05759   profilin Organism char  Clupea harengus (Atlantic herring) Pathway char04810   Regulation of actin cytoskeleton char05132   Salmonella infection Brite KEGG Orthology (KO) [BR:char00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105911212 (pfn4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105911212 (pfn4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:char04131]     105911212 (pfn4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:char04812]     105911212 (pfn4)    04147 Exosome [BR:char04147]     105911212 (pfn4) Membrane trafficking [BR:char04131]  Others   Actin-binding proteins    Others     105911212 (pfn4) Cytoskeleton proteins [BR:char04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105911212 (pfn4) Exosome [BR:char04147]  Exosomal proteins   Proteins found in most exosomes    105911212 (pfn4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105911212 NCBI-ProteinID:  XP_031435994 Ensembl:  ENSCHAG00000008901 UniProt:  A0A6P8G9C1 LinkDB All DBs Position 14:1858156..1859933 Genome browser AA seq 128 aa AA seqDB search MSQFHSLIYDCLIDTRHVEHAAILLPKKTIPVAASTHFKLSSQQVQMFADAFKQLTYTRE NGFYFQERLFSCVRSDKNSIYSKCGGHGLLLVKTALFIIVVTYNENMYPSVCVEAVEKLA EYLRDKGK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagtcagtttcatagtctcatctatgactgcctgattgacacaagacacgtagaacat gcggcaatattactaccaaaaaagacaatccctgtggcggcatccacacactttaagttg tcgtcacaacaggtacaaatgtttgcggacgctttcaaacagttgacgtatacgagagag aatggattctactttcaagagaggttattctcttgtgtccggtctgacaagaattctatt tactccaaatgtggagggcatggcttgctgctggtaaagacagctctgttcatcattgta gttacatacaacgaaaacatgtaccccagtgtgtgtgtggaagcagtggagaaactggca gagtatttgcgagacaaggggaaatga

DBGET integrated database retrieval system