Clupea harengus (Atlantic herring): 105912872 Help Entry 105912872         CDS       T09045                                  Name (RefSeq) dynein axonemal light chain 4   KO K10412   dynein axonemal light chain 4 Organism char  Clupea harengus (Atlantic herring) Pathway char04814   Motor proteins Brite KEGG Orthology (KO) [BR:char00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     105912872  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:char03037]     105912872    04812 Cytoskeleton proteins [BR:char04812]     105912872 Cilium and associated proteins [BR:char03037]  Motile cilia and associated proteins   Dynein arm    105912872 Cytoskeleton proteins [BR:char04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105912872 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  105912872 NCBI-ProteinID:  XP_031417318 Ensembl:  ENSCHAG00000009097 UniProt:  A0A6P8EMG0 LinkDB All DBs Position 23:22242444..22247820 Genome browser AA seq 106 aa AA seqDB search MAETGDGKKEEADYKRLHSFPLIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKE TMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagagacaggtgatggcaagaaggaagaagccgactacaagagactccacagtttt cctctcatcaggcatacagatatgccagaggagatgcgagttgagaccatggagctgtgc gttactgcctgtgagaagtttgccaccaacaacgagagtgcagcgaagatgataaaggag acgatggataagaagtttggcagctcgtggcacgtggtcatcggcgagggtttcggcttc gaggtcacgcacgaggtcaagaacctgctctacatgttcttcggcgggagcctggccgtg tgtgtgtggaagtgctcctag

DBGET integrated database retrieval system