Clupea harengus (Atlantic herring): 116218708 Help Entry 116218708         CDS       T09045                                  Symbol gng14 Name (RefSeq) GGL domain-containing protein   KO K04347   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Organism char  Clupea harengus (Atlantic herring) Pathway char04010   MAPK signaling pathway char04081   Hormone signaling char04082   Neuroactive ligand signaling char04371   Apelin signaling pathway char04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116218708 (gng14)    04371 Apelin signaling pathway     116218708 (gng14)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     116218708 (gng14)    04081 Hormone signaling     116218708 (gng14)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116218708 (gng14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     116218708 (gng14)    04031 GTP-binding proteins [BR:char04031]     116218708 (gng14) Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    116218708 (gng14)   Exosomal proteins of colorectal cancer cells    116218708 (gng14) GTP-binding proteins [BR:char04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     116218708 (gng14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  116218708 NCBI-ProteinID:  XP_031417094 Ensembl:  ENSCHAG00000006566 UniProt:  A0A6P8EXM9 LinkDB All DBs Position 23:24327552..24328544 Genome browser AA seq 72 aa AA seqDB search MEGKVCSGNNVLQARKAVEQLRVEANIERVKISVAAAQLVQYCQEHIRSDPLITGIATSA NPFKDKKSCVLI NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggaggggaaggtgtgcagtggtaataacgtgctccaggcgaggaaagcggtggagcag ctcagagtggaggcaaacatcgagagggtcaagatctccgtggcagcggctcagctggtt cagtactgccaggagcacatccggtccgaccccctaatcacgggcatcgccacctccgcc aaccccttcaaggacaagaaaagctgtgtgctaatctag

DBGET integrated database retrieval system