Clupea harengus (Atlantic herring): 122130990 Help Entry 122130990         CDS       T09045                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism char  Clupea harengus (Atlantic herring) Pathway char04020   Calcium signaling pathway char04070   Phosphatidylinositol signaling system char04114   Oocyte meiosis char04218   Cellular senescence char04261   Adrenergic signaling in cardiomyocytes char04270   Vascular smooth muscle contraction char04371   Apelin signaling pathway char04625   C-type lectin receptor signaling pathway char04744   Phototransduction char04910   Insulin signaling pathway char04912   GnRH signaling pathway char04916   Melanogenesis Brite KEGG Orthology (KO) [BR:char00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     122130990    04020 Calcium signaling pathway     122130990    04070 Phosphatidylinositol signaling system     122130990  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     122130990    04218 Cellular senescence     122130990  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122130990   09152 Endocrine system    04910 Insulin signaling pathway     122130990    04912 GnRH signaling pathway     122130990    04916 Melanogenesis     122130990   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     122130990    04270 Vascular smooth muscle contraction     122130990   09157 Sensory system    04744 Phototransduction     122130990  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:char01009]     122130990   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:char04131]     122130990    03036 Chromosome and associated proteins [BR:char03036]     122130990   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     122130990 Protein phosphatases and associated proteins [BR:char01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122130990 Membrane trafficking [BR:char04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122130990 Chromosome and associated proteins [BR:char03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122130990 Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122130990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N EFhand_Ca_insen Dockerin_1 EF-hand_EFHB_C FCaBP_EF-hand Caleosin DUF5580_M DUF1103 TerB SPEF2_C EF-hand_STIM1 SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  122130990 NCBI-ProteinID:  XP_042561808 UniProt:  A0A8M1KHK9 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MYNRQGGSESANCHTLVFLVECGAQSSFKMADQLTEEQIAEFKEAFSLFDKDGDGTITTK ELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFR VFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtacaaccgtcaaggcgggtctgaatctgctaactgtcatacacttgtgtttctggtg gagtgtggagcacagagtagtttcaaaatggctgatcaactgacagaggaacaaatcgct gaattcaaagaggcgttctcattattcgacaaagatggcgatggcaccatcaccaccaaa gaacttggcacagtcatgcgttcgctgggccagaacccaacagaggccgagctgcaggac atgatcaatgaggtggacgctgacggaaatggaacaatagacttcccagaatttctgacc atgatggcgaggaagatgaaggacaccgacagtgaagaggaaatcagagaagccttccgt gtctttgacaaggacggtaacggctacatcagcgctgcagagctgcgtcatgtcatgacc aacctgggagagaagctgacagacgaggaggtggacgagatgatcagagaagctgacatt gacggagacggccaagtcaactatgaggagtttgtacagatgatgacagcgaaatga

DBGET integrated database retrieval system