Clupea harengus (Atlantic herring): 122131044 Help Entry 122131044         CDS       T09045                                  Name (RefSeq) histone H2B 1/2-like   KO K11252   histone H2B Organism char  Clupea harengus (Atlantic herring) Brite KEGG Orthology (KO) [BR:char00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:char03036]     122131044   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     122131044 Chromosome and associated proteins [BR:char03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122131044 Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122131044 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Cytotoxic Motif Other DBs NCBI-GeneID:  122131044 NCBI-ProteinID:  XP_042561896 UniProt:  A0A8M1KCW0 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MPEPAKPAPKKGSKKAVTKTAVKGGKKRRKTRKESYAIYVYKRIAGESSRLAHYNKRSTI TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccagcgaagccagcgcccaagaagggatccaagaaagccgtgaccaagacg gctgttaaaggaggcaagaagcgccgaaagaccaggaaggagagttatgccatctacgtg tacaagcgcatcgctggggagtcttcccgcctggctcactacaacaagaggtccaccatc acctccagggagatccagaccgcagtgcgtctgcttctgcccggtgaactggccaagcac gccgtgtccgagggaacaaaggccgtcaccaagtacaccagctccaagtaa

DBGET integrated database retrieval system