Clupea harengus (Atlantic herring): 122131513 Help Entry 122131513         CDS       T09045                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism char  Clupea harengus (Atlantic herring) Pathway char04382   Cornified envelope formation char05132   Salmonella infection Brite KEGG Orthology (KO) [BR:char00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     122131513  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122131513  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:char04147]     122131513 Exosome [BR:char04147]  Exosomal proteins   Exosomal proteins of microglial cells    122131513 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  122131513 NCBI-ProteinID:  XP_042562155 UniProt:  A0A6P3VJF0 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MPSDLETSMETLIKVFHRYASKEGDSGTLSRKELKTLMEAELSGFLKSQKDPGSVDRIMK DLDTNGDGEVNFEEFVSLVVGLSIACEQCYQLHLKKGKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccttctgatttggaaacatcgatggagaccttgatcaaggtgtttcaccggtacgcg tcaaaggagggcgacagtgggacactcagtcggaaggaactgaaaacattgatggaggca gagttgtccggattcctaaagtctcagaaagatccaggctctgtggaccgcatcatgaag gatctggacactaatggcgatggcgaggtgaactttgaggagtttgtgtctctggtcgtg gggctctccatcgcttgtgagcagtgctaccagctacacttgaagaaaggaaagaagtga

DBGET integrated database retrieval system