Chlamydia psittaci 02DC15: CPS0B_1066 Help Entry CPS0B_1066        CDS       T01861                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism chi  Chlamydia psittaci 02DC15 Pathway chi00670   One carbon pool by folate chi00790   Folate biosynthesis chi01100   Metabolic pathways chi01240   Biosynthesis of cofactors chi04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:chi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CPS0B_1066    00670 One carbon pool by folate     CPS0B_1066  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CPS0B_1066 Enzymes [BR:chi01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CPS0B_1066 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 RibD_C Motif Other DBs NCBI-ProteinID:  AEG87974 LinkDB All DBs Position complement(1157446..1157889) Genome browser AA seq 147 aa AA seqDB search MGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTSEGLPDKYKKNRKIIVFSRDYHESFEN VIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHIHKCYEGDVFFPLSLI KGWRKTVLDEKENLTFCFYENFADCHS NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgggaaagcaaggaaagcttccgtggaactatcctgaagatatcgaatttttttccaaa actataggaaatcatgtcctaatcatggggagaaagacttctgagggtcttcctgataag tataagaagaaccggaagattattgtcttttccagggattatcatgaaagtttcgagaat gtaatctgggtatcttctttagaggaatttagacgtttagaacaactttcttctattttt cttattggcggaggagaattgttttctttatttttagaaaatcggatggtggatgggtgt ttcataactcatattcacaagtgttatgagggtgatgttttcttccctctatctttaatc aaagggtggaggaaaactgttttagatgagaaagagaacttaacattttgtttttatgaa aatttcgccgattgtcactcgtag

DBGET integrated database retrieval system