Chlamydia psittaci 6BC: CPSIT_1058 Help Entry CPSIT_1058        CDS       T01481                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism chp  Chlamydia psittaci 6BC Pathway chp00670   One carbon pool by folate chp00790   Folate biosynthesis chp01100   Metabolic pathways chp01240   Biosynthesis of cofactors chp04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:chp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CPSIT_1058    00670 One carbon pool by folate     CPSIT_1058  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CPSIT_1058 Enzymes [BR:chp01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CPSIT_1058 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 RibD_C Motif Other DBs NCBI-ProteinID:  ADZ18938 LinkDB All DBs Position complement(1156923..1157366) Genome browser AA seq 147 aa AA seqDB search MGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTSEGLPDKYKKNRKIIVFSRDYHESFEN VIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHIHKCYEGDVFFPLSLI KGWRKTVLDEKENLTFCFYENFADCHS NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgggaaagcaaggaaagcttccgtggaactatcctgaagatatcgaatttttttccaaa actataggaaatcatgtcctaatcatggggagaaagacttctgagggtcttcctgataag tataagaagaaccggaagattattgtcttttccagggattatcatgaaagtttcgagaat gtaatctgggtatcttctttagaggaatttagacgtttagaacaactttcttctattttt cttattggcggaggagaattgttttctttatttttagaaaatcggatggtggatgggtgt ttcataactcatattcacaagtgttatgagggtgatgttttcttccctctatctttaatc aaagggtggaggaaaactgttttagatgagaaagagaacttaacattttgtttttatgaa aatttcgccgattgtcactcgtag

DBGET integrated database retrieval system