Chlamydia psittaci 08DC60: CPS0D_1076 Help Entry CPS0D_1076        CDS       T01862                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism cht  Chlamydia psittaci 08DC60 Pathway cht00670   One carbon pool by folate cht00790   Folate biosynthesis cht01100   Metabolic pathways cht01240   Biosynthesis of cofactors cht04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:cht00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CPS0D_1076    00670 One carbon pool by folate     CPS0D_1076  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     CPS0D_1076 Enzymes [BR:cht01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      CPS0D_1076 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 RibD_C Motif Other DBs NCBI-ProteinID:  AEG88947 LinkDB All DBs Position complement(1157295..1157738) Genome browser AA seq 147 aa AA seqDB search MGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTSEGLPDKYKKNRKIIVFSRDYHESFEN VIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHIHKCYEGDVFFPLSLI KGWRKTVLDEKENLTFCFYENFADCHS NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgggaaagcaaggaaagcttccgtggaactatcctgaagatatcgaatttttttccaaa actataggaaatcatgtcctaatcatggggagaaagacttctgagggtcttcctgataag tataagaagaaccggaagattattgtcttttccagggattatcatgaaagtttcgagaat gtaatctgggtatcttctttagaggaatttagacgtttagaacaactttcttctattttt cttattggcggaggagaattgttttctttatttttagaaaatcggatggtggatgggtgt ttcataactcatattcacaagtgttatgagggtgatgttttcttccctctatctttaatc aaagggtggaggaaaactgttttagatgagaaagagaacttaacattttgtttttatgaa aatttcgccgattgtcactcgtag

DBGET integrated database retrieval system