Campylobacter hepaticus: A2J15_007295 Help Entry A2J15_007295      CDS       T05589                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism chw  Campylobacter hepaticus Pathway chw00790   Folate biosynthesis chw01100   Metabolic pathways chw01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:chw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     A2J15_007295 Enzymes [BR:chw01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      A2J15_007295  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      A2J15_007295  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      A2J15_007295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF6953 Motif Other DBs NCBI-ProteinID:  AXP09451 UniProt:  A0A424Z323 LinkDB All DBs Position complement(1468134..1468451) Genome browser AA seq 105 aa AA seqDB search MQSHIKIKFRFQCIIGILDFERKKKQTIIIKLKAKSDEFLNYSEIITKIKTYYKKEKFYT LEESLDFISLNLKKDFLYLTHLNIEVFKPNIIKNAKVGVKLKKKY NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcaaagtcatataaaaataaaatttcgttttcaatgtattattggaatcttagatttt gaaagaaaaaaaaagcaaacaattatcattaaacttaaagctaaatcagatgaattttta aattattctgaaataattaccaaaatcaaaacatactataaaaaagaaaaattttatact cttgaagaatctcttgattttataagtttaaatttaaaaaaagattttctatatctaact catcttaacatagaagtttttaaaccaaatattataaaaaatgctaaagttggggttaag ttgaaaaaaaaatattaa

DBGET integrated database retrieval system