Capra hircus (goat): 100860814 Help Entry 100860814         CDS       T02910                                  Symbol IL4 Name (RefSeq) interleukin-4 precursor   KO K05430   interleukin 4 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04630   JAK-STAT signaling pathway chx04640   Hematopoietic cell lineage chx04657   IL-17 signaling pathway chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04672   Intestinal immune network for IgA production chx05140   Leishmaniasis chx05200   Pathways in cancer chx05310   Asthma chx05320   Autoimmune thyroid disease chx05321   Inflammatory bowel disease chx05330   Allograft rejection Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100860814 (IL4)    04151 PI3K-Akt signaling pathway     100860814 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100860814 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100860814 (IL4)    04660 T cell receptor signaling pathway     100860814 (IL4)    04658 Th1 and Th2 cell differentiation     100860814 (IL4)    04659 Th17 cell differentiation     100860814 (IL4)    04657 IL-17 signaling pathway     100860814 (IL4)    04664 Fc epsilon RI signaling pathway     100860814 (IL4)    04672 Intestinal immune network for IgA production     100860814 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100860814 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100860814 (IL4)   09163 Immune disease    05310 Asthma     100860814 (IL4)    05320 Autoimmune thyroid disease     100860814 (IL4)    05321 Inflammatory bowel disease     100860814 (IL4)    05330 Allograft rejection     100860814 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     100860814 (IL4)    00536 Glycosaminoglycan binding proteins [BR:chx00536]     100860814 (IL4) Cytokines and neuropeptides [BR:chx04052]  Cytokines   Interleukins    100860814 (IL4) Glycosaminoglycan binding proteins [BR:chx00536]  Heparan sulfate / Heparin   Cytokines    100860814 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  100860814 NCBI-ProteinID:  NP_001272610 UniProt:  P79155 LinkDB All DBs Position 7:88878436..88886254 Genome browser AA seq 135 aa AA seqDB search MGLTSQLIPALVCLLVCTSHFVHGHKCDITLEEIIKMLNILTSQKNSCMELPVADVFAAP KNATEKETFCRAGIELRRIYRNHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDL LERLKTIMKEKYSKC NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagctgattccagcgctggtctgcttactggtatgtaccagccac ttcgtccatggacacaagtgtgacattaccttagaagagatcatcaaaatgctgaacatc ctcacatcgcagaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca aagaatgcaactgagaaggaaaccttctgcagggctggaattgagcttaggcgtatctac aggaaccacatgtgcttgaacaaattcctgggcggacttgacaggaatctcagcagcttg gcaagcaagacctgttctgtgaatgaagccaagacaagtacaagtacgctgagagacctc ttggaaaggctaaagactattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system