Capra hircus (goat): 100860883 Help Entry 100860883         CDS       T02910                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism chx  Capra hircus (goat) Pathway chx03082   ATP-dependent chromatin remodeling chx04015   Rap1 signaling pathway chx04145   Phagosome chx04210   Apoptosis chx04390   Hippo signaling pathway chx04510   Focal adhesion chx04520   Adherens junction chx04530   Tight junction chx04611   Platelet activation chx04613   Neutrophil extracellular trap formation chx04670   Leukocyte transendothelial migration chx04714   Thermogenesis chx04810   Regulation of actin cytoskeleton chx04814   Motor proteins chx04820   Cytoskeleton in muscle cells chx04919   Thyroid hormone signaling pathway chx04921   Oxytocin signaling pathway chx04971   Gastric acid secretion chx05014   Amyotrophic lateral sclerosis chx05100   Bacterial invasion of epithelial cells chx05132   Salmonella infection chx05135   Yersinia infection chx05164   Influenza A chx05205   Proteoglycans in cancer chx05225   Hepatocellular carcinoma chx05410   Hypertrophic cardiomyopathy chx05412   Arrhythmogenic right ventricular cardiomyopathy chx05414   Dilated cardiomyopathy chx05416   Viral myocarditis chx05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100860883 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100860883 (ACTG1)    04390 Hippo signaling pathway     100860883 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100860883 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     100860883 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100860883 (ACTG1)    04520 Adherens junction     100860883 (ACTG1)    04530 Tight junction     100860883 (ACTG1)   09142 Cell motility    04814 Motor proteins     100860883 (ACTG1)    04820 Cytoskeleton in muscle cells     100860883 (ACTG1)    04810 Regulation of actin cytoskeleton     100860883 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100860883 (ACTG1)    04613 Neutrophil extracellular trap formation     100860883 (ACTG1)    04670 Leukocyte transendothelial migration     100860883 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     100860883 (ACTG1)    04919 Thyroid hormone signaling pathway     100860883 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     100860883 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     100860883 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100860883 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100860883 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     100860883 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     100860883 (ACTG1)    05135 Yersinia infection     100860883 (ACTG1)    05100 Bacterial invasion of epithelial cells     100860883 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100860883 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100860883 (ACTG1)    05410 Hypertrophic cardiomyopathy     100860883 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     100860883 (ACTG1)    05414 Dilated cardiomyopathy     100860883 (ACTG1)    05416 Viral myocarditis     100860883 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:chx03021]     100860883 (ACTG1)    03019 Messenger RNA biogenesis [BR:chx03019]     100860883 (ACTG1)    03036 Chromosome and associated proteins [BR:chx03036]     100860883 (ACTG1)    03029 Mitochondrial biogenesis [BR:chx03029]     100860883 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:chx04812]     100860883 (ACTG1)    04147 Exosome [BR:chx04147]     100860883 (ACTG1) Transcription machinery [BR:chx03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100860883 (ACTG1) Messenger RNA biogenesis [BR:chx03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100860883 (ACTG1) Chromosome and associated proteins [BR:chx03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100860883 (ACTG1)     NuA4 complex      100860883 (ACTG1)   Chromatin remodeling factors    BAF complex     100860883 (ACTG1)    PBAF complex     100860883 (ACTG1)    GBAF(ncBAF) complex     100860883 (ACTG1)    SWR1 complex     100860883 (ACTG1) Mitochondrial biogenesis [BR:chx03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100860883 (ACTG1) Cytoskeleton proteins [BR:chx04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100860883 (ACTG1) Exosome [BR:chx04147]  Exosomal proteins   Proteins found in most exosomes    100860883 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100860883 NCBI-ProteinID:  XP_017919092 UniProt:  A0A452G8J3 LinkDB All DBs Position 19:50629570..50632457 Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaattgccgccctcgtcatcgacaatggttctggcatgtgcaaagctggc tttgctggggatgacgccccccgggccgtgttcccgtccatcgttgggcgtccccgacac cagggcgtcatggtgggcatggggcagaaggacagctacgtgggcgacgaggcccagagc aagcgtggcatcctaacccttaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag caccccgtgctgctgacggaggcccctctgaaccccaaggccaaccgtgagaagatgacc cagatcatgttcgagactttcaacactcctgccatgtatgtggccatccaggctgtgctg tccctgtacgcctctggccgcaccactggcattgtcatggactctggggacggggtcacc cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctcacggaacgtggttacagcttt accaccacagccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtcgcc ctggacttcgagcaggagatggctactgctgcgtcgtcctcctccttggagaagagctat gagctgcccgatggtcaggtgatcaccattggcaacgagcggttccggtgtcccgaggcg ctcttccagccgtccttcctgggtatggagtcctgtggcatccacgagaccaccttcaat tccatcatgaagtgtgacgtggacatccgaaaggacctgtatgccaacacggtgctgtct ggtggcaccaccatgtaccctggcatcgccgacaggatgcagaaggagatcaccgcgctg gctccgagcacgatgaagatcaagatcatcgctcctcccgagcgcaagtactcggtgtgg atcggaggctccatcctggcctccctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtctggcccctccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system