Capra hircus (goat): 102171306 Help Entry 102171306         CDS       T02910                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism chx  Capra hircus (goat) Pathway chx01522   Endocrine resistance chx04110   Cell cycle chx04115   p53 signaling pathway chx04151   PI3K-Akt signaling pathway chx04218   Cellular senescence chx04530   Tight junction chx04660   T cell receptor signaling pathway chx04933   AGE-RAGE signaling pathway in diabetic complications chx04934   Cushing syndrome chx05160   Hepatitis C chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05169   Epstein-Barr virus infection chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05212   Pancreatic cancer chx05214   Glioma chx05218   Melanoma chx05219   Bladder cancer chx05220   Chronic myeloid leukemia chx05222   Small cell lung cancer chx05223   Non-small cell lung cancer chx05224   Breast cancer chx05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     102171306 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102171306 (CDK4)    04115 p53 signaling pathway     102171306 (CDK4)    04218 Cellular senescence     102171306 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     102171306 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     102171306 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102171306 (CDK4)    05203 Viral carcinogenesis     102171306 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     102171306 (CDK4)    05225 Hepatocellular carcinoma     102171306 (CDK4)    05214 Glioma     102171306 (CDK4)    05220 Chronic myeloid leukemia     102171306 (CDK4)    05218 Melanoma     102171306 (CDK4)    05219 Bladder cancer     102171306 (CDK4)    05224 Breast cancer     102171306 (CDK4)    05222 Small cell lung cancer     102171306 (CDK4)    05223 Non-small cell lung cancer     102171306 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102171306 (CDK4)    05160 Hepatitis C     102171306 (CDK4)    05164 Influenza A     102171306 (CDK4)    05162 Measles     102171306 (CDK4)    05163 Human cytomegalovirus infection     102171306 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     102171306 (CDK4)    05169 Epstein-Barr virus infection     102171306 (CDK4)    05165 Human papillomavirus infection     102171306 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102171306 (CDK4)    04934 Cushing syndrome     102171306 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102171306 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:chx01001]     102171306 (CDK4) Enzymes [BR:chx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      102171306 (CDK4) Protein kinases [BR:chx01001]  Serine/threonine kinases: CMGC group   CDK family    102171306 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  102171306 NCBI-ProteinID:  XP_005680323 UniProt:  A0A452FEV7 LinkDB All DBs Position 5:55055732..55058821 Genome browser AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG DAE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatatgagccagtggctgagattggtgtcggtgcctatgggacagtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtcccc aatggaggaggtgctggagggggcctgcccatcagcaccgttcgggaggtggccttactg cggcgtctggaggcttttgagcatcccaatgttgtcaggctcatggacgtctgtgcaaca gcccgaactgaccgggagaccaaagtgaccctggtgtttgagcatgtggaccaagacctc aggacgtatctggacaaggcacccccaccaggcttgccagtagagaccataaaggatctg atgcgccagtttctaagaggcctggatttccttcatgccaactgcatcgttcaccgagac ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtat cgtgctccagaagttcttttgcagtctacgtatgcaacacctgtggacatgtggagtgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttttgtggaaactctgaagct gaccagttaggcaaaatctttgacctgatcggactgcccccggaggatgactggccccga gatgtctctctaccccgaggagccttttcccccagagggccccgcccagtgcagtcggtg gtccctgagctggaggaatctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacacaaggcagaaggt gacgcagagtga

DBGET integrated database retrieval system