Capra hircus (goat): 102174543 Help Entry 102174543         CDS       T02910                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism chx  Capra hircus (goat) Pathway chx04010   MAPK signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04024   cAMP signaling pathway chx04062   Chemokine signaling pathway chx04510   Focal adhesion chx04520   Adherens junction chx04611   Platelet activation chx04670   Leukocyte transendothelial migration chx04720   Long-term potentiation chx04722   Neurotrophin signaling pathway chx04934   Cushing syndrome chx04972   Pancreatic secretion chx05211   Renal cell carcinoma chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102174543 (RAP1B)    04014 Ras signaling pathway     102174543 (RAP1B)    04015 Rap1 signaling pathway     102174543 (RAP1B)    04024 cAMP signaling pathway     102174543 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102174543 (RAP1B)    04520 Adherens junction     102174543 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102174543 (RAP1B)    04670 Leukocyte transendothelial migration     102174543 (RAP1B)    04062 Chemokine signaling pathway     102174543 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     102174543 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     102174543 (RAP1B)    04722 Neurotrophin signaling pathway     102174543 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     102174543 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102174543 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102174543 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102174543 (RAP1B)    04031 GTP-binding proteins [BR:chx04031]     102174543 (RAP1B) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102174543 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    102174543 (RAP1B)   Exosomal proteins of colorectal cancer cells    102174543 (RAP1B) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     102174543 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  102174543 NCBI-ProteinID:  NP_001274162 UniProt:  I1W1N1 LinkDB All DBs Position 5:complement(44527498..44574832) Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat aggaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacggatgatgttccgatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcacgacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcgtca tgtcagctgctttaa

DBGET integrated database retrieval system