Capra hircus (goat): 102177696 Help Entry 102177696         CDS       T02910                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism chx  Capra hircus (goat) Pathway chx00510   N-Glycan biosynthesis chx00513   Various types of N-glycan biosynthesis chx04141   Protein processing in endoplasmic reticulum Module chx_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:chx00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     102177696 (TMEM258)    00513 Various types of N-glycan biosynthesis     102177696 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102177696 (TMEM258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  102177696 NCBI-ProteinID:  XP_005699820 LinkDB All DBs Position 29 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaacttgaggccatgagcagatacaccagccccgtgaacccggctgtctttccccac ctgaccgttgtgctgctggccattggcatgttcttcaccgcctggttcttcgtttatgag gtcacatccaccaagtacacccgggatatctacaaagagctcctcatctccctggtggcc tcactcttcatgggctttggagtcctcttcctgctgctctgggtcggcatctacatatga

DBGET integrated database retrieval system