Capra hircus (goat): 102181974 Help Entry 102181974         CDS       T02910                                  Symbol NPPA Name (RefSeq) natriuretic peptides A precursor   KO K12334   natriuretic peptide A Organism chx  Capra hircus (goat) Pathway chx04022   cGMP-PKG signaling pathway chx04024   cAMP signaling pathway chx04066   HIF-1 signaling pathway chx04081   Hormone signaling chx04270   Vascular smooth muscle contraction chx04714   Thermogenesis chx04921   Oxytocin signaling pathway chx04923   Regulation of lipolysis in adipocytes chx04924   Renin secretion chx04925   Aldosterone synthesis and secretion chx05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102181974 (NPPA)    04024 cAMP signaling pathway     102181974 (NPPA)    04022 cGMP-PKG signaling pathway     102181974 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102181974 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102181974 (NPPA)    04921 Oxytocin signaling pathway     102181974 (NPPA)    04924 Renin secretion     102181974 (NPPA)    04925 Aldosterone synthesis and secretion     102181974 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102181974 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     102181974 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     102181974 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102181974 (NPPA) Cytokines and neuropeptides [BR:chx04052]  Neuropeptides   Unclassified    102181974 (NPPA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  102181974 NCBI-ProteinID:  NP_001274165 UniProt:  R4N479 LinkDB All DBs Position 16:40323266..40324470 Genome browser AA seq 152 aa AA seqDB search MGSSAITTSFLLFLAFQLPGQTGANPVYGSVSNADLMDFKNLLDRLEDKMPLEDEAVPSQ VLSEQNEEAGAPLSPLSEVPPWMGEVNAAQRDGGALGRGPWESSDRSALLKSKLRALLTA PRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgggctcctctgccatcaccacgagcttcctcctctttctggcgtttcagctcccaggg caaacaggagcaaatcctgtgtatggctctgtgtccaatgcagacctgatggatttcaag aatttgctggaccgtttggaggacaagatgcctttagaagatgaggctgtgccctcacaa gtattaagtgagcagaatgaagaagctggggcccctctcagccctctttcagaggtgcct ccctggatgggggaggtcaacgcagcccagagagatgggggcgccctcgggcggggaccc tgggaatcctccgatagatctgccctcctgaagagcaagctgagggcactgctcactgcc cctcggagcctgcggaggtccagctgcttcgggggaaggatggacaggattggagcccag agtggattgggctgcaacagcttccggtatcgaagataa

DBGET integrated database retrieval system