Capra hircus (goat): 102182115 Help Entry 102182115         CDS       T02910                                  Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04061   Viral protein interaction with cytokine and cytokine receptor chx04062   Chemokine signaling pathway chx04064   NF-kappa B signaling pathway chx04621   NOD-like receptor signaling pathway chx04657   IL-17 signaling pathway chx04668   TNF signaling pathway chx04936   Alcoholic liver disease chx05134   Legionellosis chx05146   Amoebiasis chx05167   Kaposi sarcoma-associated herpesvirus infection chx05323   Rheumatoid arthritis chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102182115    04668 TNF signaling pathway     102182115   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102182115    04061 Viral protein interaction with cytokine and cytokine receptor     102182115  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102182115    04657 IL-17 signaling pathway     102182115    04062 Chemokine signaling pathway     102182115  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102182115   09171 Infectious disease: bacterial    05134 Legionellosis     102182115   09174 Infectious disease: parasitic    05146 Amoebiasis     102182115   09163 Immune disease    05323 Rheumatoid arthritis     102182115   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102182115   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102182115  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     102182115 Cytokines and neuropeptides [BR:chx04052]  Cytokines   Chemokines    102182115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102182115 NCBI-ProteinID:  XP_017905064 LinkDB All DBs Position 6:89467768..89469881 Genome browser AA seq 103 aa AA seqDB search MARAANAAARLLGAAMLLLLLVAAGRRAAGAPVVNELRCQCLQTVQGIHLKNMQSVKVTP PGPHCGQAEVIATLKTGQEVCLNPAAPMVKKIIDKMLNQASSN NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcccgagccgcgaacgccgccgcccggctcctcggcgccgcgatgctgctcctgctc ctggtggccgccggccggcgcgcagcaggggcgcccgtggtcaacgaactgcgctgccag tgcctgcagaccgtgcaggggattcacctcaagaacatgcagagcgtgaaggtgacgccc ccgggcccccactgcggccaagccgaagtcatagccactctcaagactggtcaggaagtg tgtctcaaccccgccgcccccatggttaagaaaatcatcgataagatgctaaaccaggcc agctccaactga

DBGET integrated database retrieval system