KEGG   Capra hircus (goat): 102187922
Entry
102187922         CDS       T02910                                 
Symbol
DCTN2
Name
(RefSeq) dynactin subunit 2 isoform X1
  KO
K10424  dynactin 2
Organism
chx  Capra hircus (goat)
Pathway
chx04814  Motor proteins
chx04962  Vasopressin-regulated water reabsorption
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09142 Cell motility
   04814 Motor proteins
    102187922 (DCTN2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102187922 (DCTN2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102187922 (DCTN2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102187922 (DCTN2)
   05016 Huntington disease
    102187922 (DCTN2)
   05022 Pathways of neurodegeneration - multiple diseases
    102187922 (DCTN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102187922 (DCTN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:chx04812]
    102187922 (DCTN2)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    Dynactin complex
     102187922 (DCTN2)
Cytoskeleton proteins [BR:chx04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     102187922 (DCTN2)
SSDB
Motif
Pfam: Dynamitin DUF7310 ALIX_LYPXL_bnd ZapB
Other DBs
NCBI-GeneID: 102187922
NCBI-ProteinID: XP_017903516
LinkDB
Position
5:55259174..55272936
AA seq 408 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAELEELTSTSVEHIIVNPNAAYDKFK
DKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVE
KIKTTVKESATEEKLTPVVLAKQLATLKQQLVASHLEKLLGPDAAINLTDPDGALAKRLL
LQLEATKNSKGTGSGGKTTSGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEA
TVRCDQDAQNPLSAGLQGACLMDTVELLQAKVGALDLAVLDQVEARLQSVLGKVNEIAKH
KASVEDADTQSKVHQLYETIQRWSPIATSLPELVQRLVTIKQLHEQAMQFGQLLTHLDTT
QQMIACSLKDNATLLTQVQTTMRENLSTIEGNFANIDERMKKLGKPQG
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcggaccctaagtacgccgaccttcccggcattgccaggaacgagccagatgtttat
gaaaccagcgacctgcctgaggatgatcaagcagagtttgatgcggagctggaggagctg
accagtaccagtgtggagcacatcattgtcaatcccaatgctgcctatgacaagttcaaa
gacaagagagtgggcacaaagggacttgatttctcagatcgaattggaaaaaccaaaaga
acgggatatgaatctggagaatatgagatgcttggagagggtctgggagtaaaggagaca
ccccagcaaaagtaccagagactactgcatgaggtccaagagctgacaactgaagttgaa
aaaatcaagacgacagtgaaggaatcagccactgaggagaagctgacccccgtggtgttg
gctaaacagctggccaccctgaagcagcagctggttgcttcccatctggagaagctgctg
ggaccagatgccgcaatcaaccttactgaccccgatggagctctggctaagcgcctattg
ctgcagctggaagcaacaaagaacagcaaagggactggttcagggggcaagaccaccagt
gggacccccccagatagcagcttggtcacttatgaactgcattctcggcctgagcaggac
aagttctctcaagctgccaaagtggcagaactcgagaagcgcctgacagagctggaagcc
actgtacgctgtgatcaggatgctcagaatcccctttcagcaggtctgcagggagcctgc
ctcatggatactgtagagctgttgcaggcgaaggtgggcgccctggaccttgcagttttg
gaccaagtggaggctcggttacagagtgtgctgggaaaagtgaatgagattgccaagcat
aaagcttctgtagaggatgcagatacacagagcaaggtgcaccagctgtatgaaaccata
cagcgctggagccccattgccacctcccttcctgagctggtacagagacttgtcaccatc
aagcagctacacgaacaagccatgcagtttggtcagcttctgacacacttggataccaca
cagcagatgattgcttgttccctcaaggacaatgccaccctcttgactcaggtgcagacg
acgatgcgtgaaaacctgtccacaattgaggggaactttgccaacattgatgaacggatg
aagaaactgggaaagccacagggatga

DBGET integrated database retrieval system