Capra hircus (goat): 102187922
Help
Entry
102187922 CDS
T02910
Symbol
DCTN2
Name
(RefSeq) dynactin subunit 2 isoform X1
KO
K10424
dynactin 2
Organism
chx
Capra hircus (goat)
Pathway
chx04814
Motor proteins
chx04962
Vasopressin-regulated water reabsorption
chx05014
Amyotrophic lateral sclerosis
chx05016
Huntington disease
chx05022
Pathways of neurodegeneration - multiple diseases
chx05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
chx00001
]
09140 Cellular Processes
09142 Cell motility
04814 Motor proteins
102187922 (DCTN2)
09150 Organismal Systems
09155 Excretory system
04962 Vasopressin-regulated water reabsorption
102187922 (DCTN2)
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
102187922 (DCTN2)
09164 Neurodegenerative disease
05014 Amyotrophic lateral sclerosis
102187922 (DCTN2)
05016 Huntington disease
102187922 (DCTN2)
05022 Pathways of neurodegeneration - multiple diseases
102187922 (DCTN2)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
chx03036
]
102187922 (DCTN2)
09183 Protein families: signaling and cellular processes
04812 Cytoskeleton proteins [BR:
chx04812
]
102187922 (DCTN2)
Chromosome and associated proteins [BR:
chx03036
]
Eukaryotic type
Centrosome formation proteins
Microtubules and associated factors
Dynactin complex
102187922 (DCTN2)
Cytoskeleton proteins [BR:
chx04812
]
Eukaryotic cytoskeleton proteins
Microtubules
Tubulin-binding proteins
Dynactins
102187922 (DCTN2)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Dynamitin
DUF7310
ALIX_LYPXL_bnd
ZapB
Motif
Other DBs
NCBI-GeneID:
102187922
NCBI-ProteinID:
XP_017903516
LinkDB
All DBs
Position
5:55259174..55272936
Genome browser
AA seq
408 aa
AA seq
DB search
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAELEELTSTSVEHIIVNPNAAYDKFK
DKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVE
KIKTTVKESATEEKLTPVVLAKQLATLKQQLVASHLEKLLGPDAAINLTDPDGALAKRLL
LQLEATKNSKGTGSGGKTTSGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEA
TVRCDQDAQNPLSAGLQGACLMDTVELLQAKVGALDLAVLDQVEARLQSVLGKVNEIAKH
KASVEDADTQSKVHQLYETIQRWSPIATSLPELVQRLVTIKQLHEQAMQFGQLLTHLDTT
QQMIACSLKDNATLLTQVQTTMRENLSTIEGNFANIDERMKKLGKPQG
NT seq
1227 nt
NT seq
+upstream
nt +downstream
nt
atggcggaccctaagtacgccgaccttcccggcattgccaggaacgagccagatgtttat
gaaaccagcgacctgcctgaggatgatcaagcagagtttgatgcggagctggaggagctg
accagtaccagtgtggagcacatcattgtcaatcccaatgctgcctatgacaagttcaaa
gacaagagagtgggcacaaagggacttgatttctcagatcgaattggaaaaaccaaaaga
acgggatatgaatctggagaatatgagatgcttggagagggtctgggagtaaaggagaca
ccccagcaaaagtaccagagactactgcatgaggtccaagagctgacaactgaagttgaa
aaaatcaagacgacagtgaaggaatcagccactgaggagaagctgacccccgtggtgttg
gctaaacagctggccaccctgaagcagcagctggttgcttcccatctggagaagctgctg
ggaccagatgccgcaatcaaccttactgaccccgatggagctctggctaagcgcctattg
ctgcagctggaagcaacaaagaacagcaaagggactggttcagggggcaagaccaccagt
gggacccccccagatagcagcttggtcacttatgaactgcattctcggcctgagcaggac
aagttctctcaagctgccaaagtggcagaactcgagaagcgcctgacagagctggaagcc
actgtacgctgtgatcaggatgctcagaatcccctttcagcaggtctgcagggagcctgc
ctcatggatactgtagagctgttgcaggcgaaggtgggcgccctggaccttgcagttttg
gaccaagtggaggctcggttacagagtgtgctgggaaaagtgaatgagattgccaagcat
aaagcttctgtagaggatgcagatacacagagcaaggtgcaccagctgtatgaaaccata
cagcgctggagccccattgccacctcccttcctgagctggtacagagacttgtcaccatc
aagcagctacacgaacaagccatgcagtttggtcagcttctgacacacttggataccaca
cagcagatgattgcttgttccctcaaggacaatgccaccctcttgactcaggtgcagacg
acgatgcgtgaaaacctgtccacaattgaggggaactttgccaacattgatgaacggatg
aagaaactgggaaagccacagggatga
DBGET
integrated database retrieval system