Capra hircus (goat): 102188771 Help Entry 102188771         CDS       T02910                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism chx  Capra hircus (goat) Pathway chx03420   Nucleotide excision repair chx04066   HIF-1 signaling pathway chx04110   Cell cycle chx04114   Oocyte meiosis chx04120   Ubiquitin mediated proteolysis chx04141   Protein processing in endoplasmic reticulum chx04310   Wnt signaling pathway chx04350   TGF-beta signaling pathway chx04710   Circadian rhythm chx05170   Human immunodeficiency virus 1 infection chx05200   Pathways in cancer chx05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:chx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102188771    04120 Ubiquitin mediated proteolysis     102188771   09124 Replication and repair    03420 Nucleotide excision repair     102188771  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102188771    04350 TGF-beta signaling pathway     102188771    04066 HIF-1 signaling pathway     102188771  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102188771    04114 Oocyte meiosis     102188771  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     102188771  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102188771   09162 Cancer: specific types    05211 Renal cell carcinoma     102188771   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102188771  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:chx04121]     102188771    03400 DNA repair and recombination proteins [BR:chx03400]     102188771 Enzymes [BR:chx01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102188771 Ubiquitin system [BR:chx04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102188771   Multi subunit type E3    SCF complex     Ring finger protein      102188771    Cul2 complex      102188771    Cul3 complex      102188771    Cul4 complex      102188771    Cul7 complex      102188771    Cul8 complex      102188771    Cul9 complex      102188771 DNA repair and recombination proteins [BR:chx03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102188771     TCR (transcription coupled repair) factors      Cul4-CSA complex       102188771 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_11 zf-C3HC4_2 SCIFF Motif Other DBs NCBI-GeneID:  102188771 NCBI-ProteinID:  XP_005685182 UniProt:  A0A452DTB1 LinkDB All DBs Position 10:complement(88202334..88202851) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDTVVDNCAICRNHIMDLCIECQANQ ASAASEECTVAWGVCNHAFHFHCISRWLKTRQVCLLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatactgtggttgat aactgtgccatctgcaggaaccacattatggatctttgcatagaatgccaagccaaccaa gcgtccgctgcttctgaagagtgcaccgtggcatggggcgtctgtaaccatgctttccac ttccactgcatctctcgctggctcaaaacacggcaggtgtgtctgttggacaacagagag tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system