Capra hircus (goat): 102191340 Help Entry 102191340         CDS       T02910                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism chx  Capra hircus (goat) Pathway chx03030   DNA replication chx03410   Base excision repair chx03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:chx00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     102191340 (POLE4)    03410 Base excision repair     102191340 (POLE4)    03420 Nucleotide excision repair     102191340 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:chx03032]     102191340 (POLE4)    03400 DNA repair and recombination proteins [BR:chx03400]     102191340 (POLE4) Enzymes [BR:chx01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      102191340 (POLE4) DNA replication proteins [BR:chx03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     102191340 (POLE4) DNA repair and recombination proteins [BR:chx03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       102191340 (POLE4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  102191340 NCBI-ProteinID:  XP_017910464 UniProt:  A0A8C2XR67 LinkDB All DBs Position 11:complement(9564062..9574128) Genome browser AA seq 116 aa AA seqDB search MAAVAPGSGASREEEGTGGDAATPQPPAPTSAPGARLSRLPLARVKALVKADPDVTLAGQ EAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcggcggtggcgcctggaagcggggcttcccgggaggaggagggcaccggtggggac gcagccactccgcagcccccagccccgacgagtgcgcccggagctcgtctctcgaggctg cctctggcgcgagtgaaggccttggtgaaggcggaccccgacgtgactctcgcgggacag gaagccatcttcattctggcacgcgccgcggaactgtttgtggaaaccattgcaaaagat gcctactgttgtgctcaacaagggaagaggaaaactctccagaggagagatttggataat gcaatagaagctgtggatgaatttgcttttctggaaggtactttggattga

DBGET integrated database retrieval system