Capra hircus (goat): 108636544 Help Entry 108636544         CDS       T02910                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism chx  Capra hircus (goat) Pathway chx04060   Cytokine-cytokine receptor interaction chx04151   PI3K-Akt signaling pathway chx04217   Necroptosis chx04380   Osteoclast differentiation chx04620   Toll-like receptor signaling pathway chx04621   NOD-like receptor signaling pathway chx04622   RIG-I-like receptor signaling pathway chx04623   Cytosolic DNA-sensing pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04668   TNF signaling pathway chx04936   Alcoholic liver disease chx05135   Yersinia infection chx05142   Chagas disease chx05152   Tuberculosis chx05160   Hepatitis C chx05161   Hepatitis B chx05162   Measles chx05163   Human cytomegalovirus infection chx05164   Influenza A chx05165   Human papillomavirus infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05168   Herpes simplex virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05171   Coronavirus disease - COVID-19 chx05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     108636544    04668 TNF signaling pathway     108636544    04151 PI3K-Akt signaling pathway     108636544   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108636544  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108636544  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108636544    04621 NOD-like receptor signaling pathway     108636544    04622 RIG-I-like receptor signaling pathway     108636544    04623 Cytosolic DNA-sensing pathway     108636544    04650 Natural killer cell mediated cytotoxicity     108636544   09158 Development and regeneration    04380 Osteoclast differentiation     108636544  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108636544    05161 Hepatitis B     108636544    05160 Hepatitis C     108636544    05171 Coronavirus disease - COVID-19     108636544    05164 Influenza A     108636544    05162 Measles     108636544    05168 Herpes simplex virus 1 infection     108636544    05163 Human cytomegalovirus infection     108636544    05167 Kaposi sarcoma-associated herpesvirus infection     108636544    05169 Epstein-Barr virus infection     108636544    05165 Human papillomavirus infection     108636544   09171 Infectious disease: bacterial    05135 Yersinia infection     108636544    05152 Tuberculosis     108636544   09174 Infectious disease: parasitic    05142 Chagas disease     108636544   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108636544   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     108636544  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:chx04052]     108636544 Cytokines and neuropeptides [BR:chx04052]  Cytokines   Interferons    108636544 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon PrlF_antitoxin Motif Other DBs NCBI-GeneID:  108636544 NCBI-ProteinID:  XP_017907393 UniProt:  A0A452DW99 LinkDB All DBs Position 8:complement(22790729..22792809) Genome browser AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALCRSYSLLRFQQERSLEVCQNLLWQLPSTPQHCLEFRMDFQ MPEEMKQAQQFRKEDAILVMYEMLQQIFNILTRDFSSTGWSDAIIEHLLEELYGQMNRLE PIQKEIMQKQTSTMGDTTDLHLRKYYFNLGQYLKSKEHNRCAWTVVQVQLLRNFSFLKSL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tgcaggagctacagcttgcttcgattccaacaagagcggagccttgaggtgtgccagaac ctcctgtggcagttaccttcaactcctcaacattgcctcgagttcaggatggacttccag atgcctgaggagatgaagcaagcacagcagttccggaaggaagatgccatattggtcatg tatgagatgctccagcagatcttcaatattctcaccagagacttctccagcactggctgg tctgacgccatcattgagcacctccttgaggaactctatgggcagatgaatcgtctggag ccaatccagaaggaaataatgcagaagcaaacctccactatgggagacacgaccgatctt cacctgaggaaatattacttcaacctcgggcagtaccttaagtccaaggagcacaacagg tgtgcctggacagtcgtgcaagtgcaattgcttaggaacttttctttcctgaagagccta acaggttacctccgtgactga

DBGET integrated database retrieval system