Clostridium hylemonae: CE91St63_20520 Help Entry CE91St63_20520    CDS       T09318                                  Name (GenBank) hypothetical protein   KO K00188   2-oxoisovalerate ferredoxin oxidoreductase delta subunit [EC:1.2.7.7] Organism chyl  Clostridium hylemonae Pathway chyl00280   Valine, leucine and isoleucine degradation chyl01100   Metabolic pathways chyl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:chyl00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     CE91St63_20520 Enzymes [BR:chyl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)      CE91St63_20520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_9 Fer4_2 Fer4_6 Fer4_10 Fer4_16 Fer4_4 Fer4_3 Fer4_8 Fer4_17 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  BDF04990 LinkDB All DBs Position complement(2233587..2233853) Genome browser AA seq 88 aa AA seqDB search MEFKSKYIVPVGADGIHVLNTGDWRTQRPVLDQETCIACGTCLLYCPVNSIRKTDGTFTI CYDYCKGCGICAHECPKNAITMIPEEGK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggagtttaaaagtaaatatatcgtgcctgtgggagcagacgggatccatgtgctcaat acaggggactggaggacacagcgcccggtactcgaccaggagacatgtattgcatgcggc acgtgccttctgtactgcccggtgaattctataagaaagacggacggaacatttacgatc tgttatgactactgtaagggatgtggaatatgtgcccatgagtgtccgaaaaatgcgatc acgatgataccggaggagggaaaataa

DBGET integrated database retrieval system