Citrus x clementina (clementine): CICLE_v10010087mg Help Entry CICLE_v10010087mg CDS       T02982                                  Name (RefSeq) hypothetical protein   KO K26502   transmembrane protein 258 Organism cic  Citrus x clementina (clementine) Pathway cic00510   N-Glycan biosynthesis cic00513   Various types of N-glycan biosynthesis cic04141   Protein processing in endoplasmic reticulum Module cic_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cic00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     CICLE_v10010087mg    00513 Various types of N-glycan biosynthesis     CICLE_v10010087mg  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CICLE_v10010087mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  18054430 NCBI-ProteinID:  XP_006451477 UniProt:  V4UF95 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MAPKPITSPVPDAWYPTLSVFMLAIGLFVTASFFIYEATSSRQNRSLGKELITGAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccaaagccgattacaagtccagtgccggatgcgtggtacccgaccctatccgtt ttcatgctcgccattggtctcttcgtcactgcttctttctttatctacgaagcaacatct tctaggcaaaatcgcagtcttggaaaggagcttataacaggagcagtagcatctgtcttc ttgggttttgggtccttattcttgcttcttgcttctggggtttatgtttaa

DBGET integrated database retrieval system