Carya illinoinensis (pecan): 122304274 Help Entry 122304274         CDS       T08745                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cill  Carya illinoinensis (pecan) Pathway cill03420   Nucleotide excision repair cill04120   Ubiquitin mediated proteolysis cill04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cill00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122304274    04120 Ubiquitin mediated proteolysis     122304274   09124 Replication and repair    03420 Nucleotide excision repair     122304274  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cill04121]     122304274    03400 DNA repair and recombination proteins [BR:cill03400]     122304274 Enzymes [BR:cill01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      122304274 Ubiquitin system [BR:cill04121]  Ubiquitin ligases (E3)   UBL E3 ligases    122304274   Multi subunit type E3    SCF complex     Ring finger protein      122304274    Cul2 complex      122304274    Cul3 complex      122304274    Cul4 complex      122304274    Cul7 complex      122304274    Cul8 complex      122304274    Cul9 complex      122304274 DNA repair and recombination proteins [BR:cill03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       122304274     TCR (transcription coupled repair) factors      Cul4-CSA complex       122304274 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  122304274 NCBI-ProteinID:  XP_042972377 LinkDB All DBs Position 3:complement(41968454..41971736) Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPAGEPSSSSVPSSSTKKNKRLEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgaccttggactccgacgtgcccatggtccctgctggcgagccctcgagcagctcc gtcccttcctcctccacgaaaaagaacaaacgcttagagatcaagaagtggaatgctgtc gctctctgggcctgggatatcgtggttgataactgtgccatttgcaggaaccatatcatg gatctatgcattgagtgccaagctaaccaggctagcgccactagcgaggaatgtacagtt gcttggggtgtttgtaaccatgcctttcatttccactgcatcagccgatggctcaagacc cgtcaagtatgtccattagataacagcgaatgggagtttcagaagtatggtcactga

DBGET integrated database retrieval system