Carya illinoinensis (pecan): 122307828 Help Entry 122307828         CDS       T08745                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cill  Carya illinoinensis (pecan) Pathway cill03420   Nucleotide excision repair cill04120   Ubiquitin mediated proteolysis cill04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cill00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122307828    04120 Ubiquitin mediated proteolysis     122307828   09124 Replication and repair    03420 Nucleotide excision repair     122307828  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cill04121]     122307828    03400 DNA repair and recombination proteins [BR:cill03400]     122307828 Enzymes [BR:cill01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      122307828 Ubiquitin system [BR:cill04121]  Ubiquitin ligases (E3)   UBL E3 ligases    122307828   Multi subunit type E3    SCF complex     Ring finger protein      122307828    Cul2 complex      122307828    Cul3 complex      122307828    Cul4 complex      122307828    Cul7 complex      122307828    Cul8 complex      122307828    Cul9 complex      122307828 DNA repair and recombination proteins [BR:cill03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       122307828     TCR (transcription coupled repair) factors      Cul4-CSA complex       122307828 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  122307828 NCBI-ProteinID:  XP_042976865 LinkDB All DBs Position 4:30251901..30257341 Genome browser AA seq 117 aa AA seqDB search MASLDSDVPMVPAGEPSSSAGPSSSKKCKHFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcctccttggactccgacgtgcccatggtcccagccggcgagccttcaagcagcgcc ggtccttcctcctccaaaaagtgcaagcacttcgagatcaagaagtggaacgccgtcgct ctctgggcctgggatatcgtggtcgataactgtgccatttgcaggaaccatatcatggat ctctgtattgagtgccaagctaatcaggctagcgccaccagcgaggaatgtacggttgct tggggggtttgcaaccatgccttccatttccattgcatcagccgatggctcaaaactcgt caagtgtgtcctttagataacagcgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system