Citrobacter sp. Y3: HAP28_05225 Help Entry HAP28_05225       CDS       T10856                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ciy  Citrobacter sp. Y3 Pathway ciy00670   One carbon pool by folate ciy00790   Folate biosynthesis ciy01100   Metabolic pathways ciy01240   Biosynthesis of cofactors ciy04981   Folate transport and metabolism Module ciy_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ciy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HAP28_05225 (folA)    00670 One carbon pool by folate     HAP28_05225 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     HAP28_05225 (folA) Enzymes [BR:ciy01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      HAP28_05225 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QIO38476 LinkDB All DBs Position 1075907..1076386 Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI VISSQPGTDDRVQWVKSVDEAITACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE GDTHFPDYEPDDWESVFSEFHDADGQNSHSYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcagtctgattgctgcgttagcggtagatcgcgttattggcatggaaaacgccatg ccgtggaatctgcctgcggatctcgcctggtttaaacgtaatacgttaaataaacctgtc gttatgggacgtcatacctgggaatccatcggccgaccgttgccgggacgtaagaacatc gtcatcagcagccagccgggtactgacgatcgcgtgcagtgggtgaaatcggttgatgaa gcgattaccgcctgtggtgatgcaccagaaattatggtgattggcggtggtcgtgtgtac gagcagttcctgcctaaagcgcagaaactgtatctgacgcacattgatgcggaagtggaa ggggatacgcatttcccggactacgagccggacgactgggaatcggtgttcagcgagttt cacgacgctgacgggcagaattcacacagctattgcttcgaaattctggaacgtcgctaa

DBGET integrated database retrieval system