Entry |
|
Symbol |
IL6
|
Name |
(RefSeq) interleukin-6 precursor
|
KO |
|
Organism |
cjc Callithrix jacchus (white-tufted-ear marmoset)
|
Pathway |
cjc01521 | EGFR tyrosine kinase inhibitor resistance |
cjc04060 | Cytokine-cytokine receptor interaction |
cjc04061 | Viral protein interaction with cytokine and cytokine receptor |
cjc04620 | Toll-like receptor signaling pathway |
cjc04621 | NOD-like receptor signaling pathway |
cjc04625 | C-type lectin receptor signaling pathway |
cjc04672 | Intestinal immune network for IgA production |
cjc04932 | Non-alcoholic fatty liver disease |
cjc04933 | AGE-RAGE signaling pathway in diabetic complications |
cjc05022 | Pathways of neurodegeneration - multiple diseases |
cjc05163 | Human cytomegalovirus infection |
cjc05166 | Human T-cell leukemia virus 1 infection |
cjc05167 | Kaposi sarcoma-associated herpesvirus infection |
cjc05168 | Herpes simplex virus 1 infection |
cjc05202 | Transcriptional misregulation in cancer |
|
Brite |
KEGG Orthology (KO) [BR:cjc00001]
09130 Environmental Information Processing
09132 Signal transduction
04630 JAK-STAT signaling pathway
100393440 (IL6)
04668 TNF signaling pathway
100393440 (IL6)
04066 HIF-1 signaling pathway
100393440 (IL6)
04068 FoxO signaling pathway
100393440 (IL6)
04151 PI3K-Akt signaling pathway
100393440 (IL6)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
100393440 (IL6)
04061 Viral protein interaction with cytokine and cytokine receptor
100393440 (IL6)
09140 Cellular Processes
09143 Cell growth and death
04218 Cellular senescence
100393440 (IL6)
09150 Organismal Systems
09151 Immune system
04640 Hematopoietic cell lineage
100393440 (IL6)
04620 Toll-like receptor signaling pathway
100393440 (IL6)
04621 NOD-like receptor signaling pathway
100393440 (IL6)
04623 Cytosolic DNA-sensing pathway
100393440 (IL6)
04625 C-type lectin receptor signaling pathway
100393440 (IL6)
04659 Th17 cell differentiation
100393440 (IL6)
04657 IL-17 signaling pathway
100393440 (IL6)
04672 Intestinal immune network for IgA production
100393440 (IL6)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
100393440 (IL6)
05202 Transcriptional misregulation in cancer
100393440 (IL6)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
100393440 (IL6)
05161 Hepatitis B
100393440 (IL6)
05171 Coronavirus disease - COVID-19
100393440 (IL6)
05164 Influenza A
100393440 (IL6)
05162 Measles
100393440 (IL6)
05168 Herpes simplex virus 1 infection
100393440 (IL6)
05163 Human cytomegalovirus infection
100393440 (IL6)
05167 Kaposi sarcoma-associated herpesvirus infection
100393440 (IL6)
05169 Epstein-Barr virus infection
100393440 (IL6)
09171 Infectious disease: bacterial
05132 Salmonella infection
100393440 (IL6)
05135 Yersinia infection
100393440 (IL6)
05133 Pertussis
100393440 (IL6)
05134 Legionellosis
100393440 (IL6)
05152 Tuberculosis
100393440 (IL6)
09174 Infectious disease: parasitic
05146 Amoebiasis
100393440 (IL6)
05144 Malaria
100393440 (IL6)
05142 Chagas disease
100393440 (IL6)
05143 African trypanosomiasis
100393440 (IL6)
09163 Immune disease
05323 Rheumatoid arthritis
100393440 (IL6)
05321 Inflammatory bowel disease
100393440 (IL6)
05332 Graft-versus-host disease
100393440 (IL6)
09164 Neurodegenerative disease
05010 Alzheimer disease
100393440 (IL6)
05020 Prion disease
100393440 (IL6)
05022 Pathways of neurodegeneration - multiple diseases
100393440 (IL6)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
100393440 (IL6)
05410 Hypertrophic cardiomyopathy
100393440 (IL6)
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
100393440 (IL6)
04932 Non-alcoholic fatty liver disease
100393440 (IL6)
04931 Insulin resistance
100393440 (IL6)
04933 AGE-RAGE signaling pathway in diabetic complications
100393440 (IL6)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
100393440 (IL6)
01523 Antifolate resistance
100393440 (IL6)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:cjc04052]
100393440 (IL6)
Cytokines and neuropeptides [BR:cjc04052]
Cytokines
Interleukins
100393440 (IL6)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
8:complement(32743741..32748168)
|
AA seq |
212 aa
MNSLSTSAFRPVAFSLGLLLVMPAAFPAPVPLGEDSKEVAAPNRQLLTSTERIDKHIRYI
LDGISALRKEICNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLLKITTGLL
EFEVYLEYLQNRFESSKEQAGAVQMSTKGLIQSLQKKAKNLSAIATPDPATNASLLTKLQ
AQDQWLQGVTTHLILRSFKEFLQNSLRALRQM |
NT seq |
639 nt +upstreamnt +downstreamnt
atgaactctctctccacaagcgccttcagaccagttgccttctccctggggctgctcctg
gtgatgcctgctgccttccctgccccagtacccctgggagaagattccaaagaggtagct
gccccaaatagacagctactcacctctacagaacgaattgacaaacacattcggtacatc
ctcgacggcatctcagccttgagaaaggagatatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggcagaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctgctgaaaatcaccactggtcttttg
gagtttgaagtatacctagagtacctccagaacaggtttgagagtagcaaggaacaagcc
ggagctgtgcagatgagtacaaaaggcctgatccagtccctgcagaaaaaggcaaagaat
ctaagtgcaatagccacccctgacccagccacaaatgccagcctgctgacgaagctgcag
gcacaggaccagtggctgcagggcgtgacgacgcatctcatcctgcgcagctttaaggag
ttcctgcagaacagtctgagggctcttcggcaaatgtag |