Condylostylus longicornis: 129610448 Help Entry 129610448         CDS       T09756                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism clon  Condylostylus longicornis Pathway clon00510   N-Glycan biosynthesis clon00513   Various types of N-glycan biosynthesis clon04141   Protein processing in endoplasmic reticulum Module clon_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:clon00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     129610448    00513 Various types of N-glycan biosynthesis     129610448  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     129610448 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Cation_efflux DUF6512 DUF4010 Motif Other DBs NCBI-GeneID:  129610448 NCBI-ProteinID:  XP_055379016 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MESMTRYVSPINPAVFPHLATVLLAIGTFFTAWFFVYEVSRPKNTKDTIFKELSISLFAS IFLGFGVLFLVLSVGIYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaatcaatgactagatatgtatcacctataaatcctgctgtatttcctcaccttgca acagttcttcttgctattggaacattttttacggcttggtttttcgtttatgaagtttca cgtccaaaaaatactaaagacaccatatttaaggagctctctataagtttattcgcatca attttcttaggttttggtgtgctatttttagttttgtcagttggaatatatgtttaa

DBGET integrated database retrieval system