Canis lupus dingo (dingo): 112641868 Help Entry 112641868         CDS       T08371                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism clud  Canis lupus dingo (dingo) Pathway clud00670   One carbon pool by folate clud00790   Folate biosynthesis clud01100   Metabolic pathways clud01240   Biosynthesis of cofactors clud01523   Antifolate resistance clud04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:clud00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     112641868    00670 One carbon pool by folate     112641868  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     112641868  09160 Human Diseases   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     112641868 Enzymes [BR:clud01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      112641868 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  112641868 NCBI-ProteinID:  XP_048948561 LinkDB All DBs Position 12:complement(18776576..18785484) Genome browser AA seq 151 aa AA seqDB search MAGDSSDAQLVVVVRAGGKSQGQLAWELLADCQDRINIVLSRDLKEPPQGAHFLAKSLDD ALKLTEQPELANKVDMVWIVGGSSVYKEAMNKPGHLRLFVTRIMHEFESDTFFPEIDLEK YKLLPEYPGVLSDVQEEKGIKYKFEVYEKND NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggcaggagacagctcagatgcacagttggtggtggtggtcagggcaggtggcaagagc caaggccaactggcctgggaattacttgcggactgtcaggacagaattaatatagttctc agcagagacctcaaggaacctccacaaggagctcattttcttgccaaaagtctggatgat gctttaaaacttactgagcaaccagaattagcaaataaagtggacatggtttggatagtg ggaggcagttctgtttataaggaagccatgaacaaaccaggccatcttagactatttgtg acaaggattatgcatgaatttgaaagtgacacgtttttcccagaaattgatttggagaaa tataaacttctgccagaatacccaggtgtgctttctgatgtccaggaggagaaaggcatt aagtacaaatttgaagtatatgagaagaacgattaa

DBGET integrated database retrieval system