Canis lupus dingo (dingo): 112647438 Help Entry 112647438         CDS       T08371                                  Symbol TP53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism clud  Canis lupus dingo (dingo) Pathway clud01522   Endocrine resistance clud01524   Platinum drug resistance clud04010   MAPK signaling pathway clud04071   Sphingolipid signaling pathway clud04110   Cell cycle clud04115   p53 signaling pathway clud04137   Mitophagy - animal clud04151   PI3K-Akt signaling pathway clud04210   Apoptosis clud04211   Longevity regulating pathway clud04216   Ferroptosis clud04218   Cellular senescence clud04310   Wnt signaling pathway clud04722   Neurotrophin signaling pathway clud04919   Thyroid hormone signaling pathway clud05012   Parkinson disease clud05014   Amyotrophic lateral sclerosis clud05016   Huntington disease clud05160   Hepatitis C clud05161   Hepatitis B clud05162   Measles clud05163   Human cytomegalovirus infection clud05165   Human papillomavirus infection clud05166   Human T-cell leukemia virus 1 infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05168   Herpes simplex virus 1 infection clud05169   Epstein-Barr virus infection clud05200   Pathways in cancer clud05202   Transcriptional misregulation in cancer clud05203   Viral carcinogenesis clud05205   Proteoglycans in cancer clud05206   MicroRNAs in cancer clud05210   Colorectal cancer clud05212   Pancreatic cancer clud05213   Endometrial cancer clud05214   Glioma clud05215   Prostate cancer clud05216   Thyroid cancer clud05217   Basal cell carcinoma clud05218   Melanoma clud05219   Bladder cancer clud05220   Chronic myeloid leukemia clud05222   Small cell lung cancer clud05223   Non-small cell lung cancer clud05224   Breast cancer clud05225   Hepatocellular carcinoma clud05226   Gastric cancer clud05230   Central carbon metabolism in cancer clud05417   Lipid and atherosclerosis clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112647438 (TP53)    04310 Wnt signaling pathway     112647438 (TP53)    04071 Sphingolipid signaling pathway     112647438 (TP53)    04151 PI3K-Akt signaling pathway     112647438 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     112647438 (TP53)   09143 Cell growth and death    04110 Cell cycle     112647438 (TP53)    04210 Apoptosis     112647438 (TP53)    04216 Ferroptosis     112647438 (TP53)    04115 p53 signaling pathway     112647438 (TP53)    04218 Cellular senescence     112647438 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     112647438 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     112647438 (TP53)   09149 Aging    04211 Longevity regulating pathway     112647438 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112647438 (TP53)    05202 Transcriptional misregulation in cancer     112647438 (TP53)    05206 MicroRNAs in cancer     112647438 (TP53)    05205 Proteoglycans in cancer     112647438 (TP53)    05203 Viral carcinogenesis     112647438 (TP53)    05230 Central carbon metabolism in cancer     112647438 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     112647438 (TP53)    05212 Pancreatic cancer     112647438 (TP53)    05225 Hepatocellular carcinoma     112647438 (TP53)    05226 Gastric cancer     112647438 (TP53)    05214 Glioma     112647438 (TP53)    05216 Thyroid cancer     112647438 (TP53)    05220 Chronic myeloid leukemia     112647438 (TP53)    05217 Basal cell carcinoma     112647438 (TP53)    05218 Melanoma     112647438 (TP53)    05219 Bladder cancer     112647438 (TP53)    05215 Prostate cancer     112647438 (TP53)    05213 Endometrial cancer     112647438 (TP53)    05224 Breast cancer     112647438 (TP53)    05222 Small cell lung cancer     112647438 (TP53)    05223 Non-small cell lung cancer     112647438 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112647438 (TP53)    05161 Hepatitis B     112647438 (TP53)    05160 Hepatitis C     112647438 (TP53)    05162 Measles     112647438 (TP53)    05168 Herpes simplex virus 1 infection     112647438 (TP53)    05163 Human cytomegalovirus infection     112647438 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     112647438 (TP53)    05169 Epstein-Barr virus infection     112647438 (TP53)    05165 Human papillomavirus infection     112647438 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     112647438 (TP53)    05014 Amyotrophic lateral sclerosis     112647438 (TP53)    05016 Huntington disease     112647438 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112647438 (TP53)    05418 Fluid shear stress and atherosclerosis     112647438 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     112647438 (TP53)    01522 Endocrine resistance     112647438 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:clud03000]     112647438 (TP53)    03036 Chromosome and associated proteins [BR:clud03036]     112647438 (TP53)    03400 DNA repair and recombination proteins [BR:clud03400]     112647438 (TP53) Transcription factors [BR:clud03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     112647438 (TP53) Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      112647438 (TP53) DNA repair and recombination proteins [BR:clud03400]  Eukaryotic type   Check point factors    Other check point factors     112647438 (TP53) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  112647438 NCBI-ProteinID:  XP_025284307 Ensembl:  ENSCAFG00020007703 UniProt:  A0A8C0K1L6 LinkDB All DBs Position 5:complement(32669973..32683547) Genome browser AA seq 381 aa AA seqDB search MQEPQSELNIDPPLSQETFSELWNLLPENNVLSSELCPAVDELLLPESVVNWLDEDSDDA PRMPATSAPTAPGPAPSWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTWTYSPLLNKL FCQLAKTCPVQLWVSSPPPPNTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQ HLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDYTTIHYNYMCNSSCMGGMNRRPIL TIITLEDSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPCPEPPPGSTKRALPPST SSSPPQKKKPLDGEYFTLQIRGRERYEMFRNLNEALELKDAQSGKEPGGSRAHSSHLKAK KGQSTSRHKKLMFKREGPDSD NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgcaagagccacagtcagagctcaatatcgacccccctctgagccaggagacattttca gaattgtggaacctgcttcctgaaaacaatgttctgtcttcggagctgtgcccagcagtg gatgagctgctgctcccagagagcgtcgtgaactggctagacgaagactcagatgatgct cccaggatgccagccacttctgcccccacagcccctggaccggccccctcctggccccta tcatcctctgtcccttccccgaagacctaccctggcacctatgggttccgtttggggttc ctgcattccgggacagccaagtctgttacttggacgtactcccctctcctcaacaagttg ttttgccagctggcgaagacctgccccgtgcagctgtgggtcagctccccacccccaccc aatacctgcgtccgcgctatggccatctataagaagtcggagttcgtgaccgaggttgtg cggcgctgcccccaccatgaacgctgctctgacagtagtgacggtcttgcccctcctcag catctcatccgagtggaaggaaatttgcgggccaagtacctggacgacagaaacactttt cgacacagtgtggtggtgccttatgagccacccgaggttggctctgactataccaccatc cactacaactacatgtgtaacagttcctgcatgggaggcatgaaccggcggcccatcctc actatcatcaccctggaagactccagtggaaacgtgctgggacgcaacagctttgaggta cgcgtttgtgcctgtcccgggagagaccgccggactgaggaggagaatttccacaagaag ggggagccttgtcctgagccaccccccgggagtaccaagcgagcactgcctcccagcacc agctcctctcccccgcaaaagaagaagccactagatggagaatatttcacccttcagatc cgtgggcgtgaacgctatgagatgttcaggaatctgaatgaagccttggagctgaaggat gcccagagtggaaaggagccagggggaagcagggctcactccagccacctgaaggcaaag aaggggcaatctacctctcgccataaaaaactgatgttcaagagagaagggcccgactca gactga

DBGET integrated database retrieval system