Canis lupus dingo (dingo): 112650215 Help Entry 112650215         CDS       T08371                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism clud  Canis lupus dingo (dingo) Pathway clud04060   Cytokine-cytokine receptor interaction clud04151   PI3K-Akt signaling pathway clud04217   Necroptosis clud04380   Osteoclast differentiation clud04620   Toll-like receptor signaling pathway clud04621   NOD-like receptor signaling pathway clud04622   RIG-I-like receptor signaling pathway clud04623   Cytosolic DNA-sensing pathway clud04630   JAK-STAT signaling pathway clud04650   Natural killer cell mediated cytotoxicity clud04668   TNF signaling pathway clud04936   Alcoholic liver disease clud05135   Yersinia infection clud05142   Chagas disease clud05152   Tuberculosis clud05160   Hepatitis C clud05161   Hepatitis B clud05162   Measles clud05163   Human cytomegalovirus infection clud05164   Influenza A clud05165   Human papillomavirus infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05168   Herpes simplex virus 1 infection clud05169   Epstein-Barr virus infection clud05170   Human immunodeficiency virus 1 infection clud05171   Coronavirus disease - COVID-19 clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112650215 (IFNB1)    04668 TNF signaling pathway     112650215 (IFNB1)    04151 PI3K-Akt signaling pathway     112650215 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112650215 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112650215 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112650215 (IFNB1)    04621 NOD-like receptor signaling pathway     112650215 (IFNB1)    04622 RIG-I-like receptor signaling pathway     112650215 (IFNB1)    04623 Cytosolic DNA-sensing pathway     112650215 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     112650215 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     112650215 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112650215 (IFNB1)    05161 Hepatitis B     112650215 (IFNB1)    05160 Hepatitis C     112650215 (IFNB1)    05171 Coronavirus disease - COVID-19     112650215 (IFNB1)    05164 Influenza A     112650215 (IFNB1)    05162 Measles     112650215 (IFNB1)    05168 Herpes simplex virus 1 infection     112650215 (IFNB1)    05163 Human cytomegalovirus infection     112650215 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     112650215 (IFNB1)    05169 Epstein-Barr virus infection     112650215 (IFNB1)    05165 Human papillomavirus infection     112650215 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     112650215 (IFNB1)    05152 Tuberculosis     112650215 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     112650215 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112650215 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112650215 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112650215 (IFNB1) Cytokines and neuropeptides [BR:clud04052]  Cytokines   Interferons    112650215 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112650215 NCBI-ProteinID:  XP_025288743 LinkDB All DBs Position 11:complement(40092714..40093509) Genome browser AA seq 197 aa AA seqDB search MVIGETLPIFIMTSRCILQTTLLLYFSTMALAMSNDLLRSQLSSSSLECQELLLQLNGTT EYCLKDRINFEIPEEIEKSHQFQKEDIILITHEMFQKIFDIFRRNISRTGWNETTVENLL VKLHWQKEHLEIILEDVKEKENFTWDNRTLLHLKKYYLRIVQYLKAKEYSICAWTIVRAE ICRNFFFLNILTDYLQN NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atggtaataggtgagactcttcccattttcatcatgaccagtagatgcatcctccaaaca actctcctgttgtatttctccaccatggctcttgccatgagcaacgacttgcttcgatcc cagctaagcagcagcagtttggagtgtcaggagctcctattacagttgaatggaaccact gaatattgcctcaaggacaggataaacttcgagatccctgaggaaatcgagaaatcacac cagttccagaaggaggacatcatattgatcacccatgagatgttccagaagatctttgat attttcaggagaaatatctctagaacaggatggaatgagaccactgtcgagaaccttctt gtgaagctccactggcagaaggaacatctggagataatcctggaggacgtcaaagagaag gaaaacttcacctgggacaacaggactcttctgcacctgaagaaatattacttaaggatt gtgcagtacctgaaggccaaggagtacagcatctgtgcctggacaatagtccgagcagaa atctgcaggaactttttcttccttaatatacttacagattatctccagaactga

DBGET integrated database retrieval system