Canis lupus dingo (dingo): 112657374 Help Entry 112657374         CDS       T08371                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism clud  Canis lupus dingo (dingo) Pathway clud01522   Endocrine resistance clud04010   MAPK signaling pathway clud04024   cAMP signaling pathway clud04210   Apoptosis clud04380   Osteoclast differentiation clud04620   Toll-like receptor signaling pathway clud04657   IL-17 signaling pathway clud04658   Th1 and Th2 cell differentiation clud04659   Th17 cell differentiation clud04660   T cell receptor signaling pathway clud04662   B cell receptor signaling pathway clud04668   TNF signaling pathway clud04713   Circadian entrainment clud04725   Cholinergic synapse clud04728   Dopaminergic synapse clud04915   Estrogen signaling pathway clud04917   Prolactin signaling pathway clud04921   Oxytocin signaling pathway clud04926   Relaxin signaling pathway clud04928   Parathyroid hormone synthesis, secretion and action clud04932   Non-alcoholic fatty liver disease clud04935   Growth hormone synthesis, secretion and action clud05031   Amphetamine addiction clud05132   Salmonella infection clud05133   Pertussis clud05135   Yersinia infection clud05140   Leishmaniasis clud05142   Chagas disease clud05161   Hepatitis B clud05162   Measles clud05166   Human T-cell leukemia virus 1 infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05170   Human immunodeficiency virus 1 infection clud05171   Coronavirus disease clud05200   Pathways in cancer clud05207   Chemical carcinogenesis - receptor activation clud05208   Chemical carcinogenesis - reactive oxygen species clud05210   Colorectal cancer clud05224   Breast cancer clud05231   Choline metabolism in cancer clud05235   PD-L1 expression and PD-1 checkpoint pathway in cancer clud05323   Rheumatoid arthritis clud05417   Lipid and atherosclerosis clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112657374 (FOS)    04668 TNF signaling pathway     112657374 (FOS)    04024 cAMP signaling pathway     112657374 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     112657374 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112657374 (FOS)    04660 T cell receptor signaling pathway     112657374 (FOS)    04658 Th1 and Th2 cell differentiation     112657374 (FOS)    04659 Th17 cell differentiation     112657374 (FOS)    04657 IL-17 signaling pathway     112657374 (FOS)    04662 B cell receptor signaling pathway     112657374 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     112657374 (FOS)    04917 Prolactin signaling pathway     112657374 (FOS)    04921 Oxytocin signaling pathway     112657374 (FOS)    04926 Relaxin signaling pathway     112657374 (FOS)    04935 Growth hormone synthesis, secretion and action     112657374 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     112657374 (FOS)   09156 Nervous system    04725 Cholinergic synapse     112657374 (FOS)    04728 Dopaminergic synapse     112657374 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     112657374 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     112657374 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112657374 (FOS)    05207 Chemical carcinogenesis - receptor activation     112657374 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     112657374 (FOS)    05231 Choline metabolism in cancer     112657374 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112657374 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     112657374 (FOS)    05224 Breast cancer     112657374 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112657374 (FOS)    05170 Human immunodeficiency virus 1 infection     112657374 (FOS)    05161 Hepatitis B     112657374 (FOS)    05171 Coronavirus disease     112657374 (FOS)    05162 Measles     112657374 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     112657374 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     112657374 (FOS)    05135 Yersinia infection     112657374 (FOS)    05133 Pertussis     112657374 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     112657374 (FOS)    05142 Chagas disease     112657374 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     112657374 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     112657374 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112657374 (FOS)    05418 Fluid shear stress and atherosclerosis     112657374 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     112657374 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     112657374 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:clud03000]     112657374 (FOS)    04131 Membrane trafficking [BR:clud04131]     112657374 (FOS) Transcription factors [BR:clud03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     112657374 (FOS) Membrane trafficking [BR:clud04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     112657374 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  112657374 NCBI-ProteinID:  XP_025299145 Ensembl:  ENSCAFG00020002082 UniProt:  A0A8C0JKQ3 LinkDB All DBs Position 8 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDTLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSIGSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATEPEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggtttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcg tccccggccggggacaccctctcctactaccactcaccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggacttctgcaccgatctggccgtctccagtgccaacttc atcccgacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccgtcccagaccagagccccccacccgtatggagtccccacc ccctcggctggggcttactccagggctggcgttgtgaagaccatgacgggaggcagagct cagagcattggccggaggggcaaggtggaacagctgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccgcaggagggag ctgactgacacgctccaagcggagacagaccaactagaagacgagaagtctgctctgcag accgagattgccaacctgctgaaggagaaggagaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggcttccccgaagagatgtccgtggcttcc ctagatctgagcgggggcctgcccgaagctgccaccccggagtccgaggaggctttcacc ctgcccctcctcaatgatcctgagcccaagccctccgtggagcccgtcaagagcatcggc agcatggagctgaaggccgagccctttgatgacttcctgtttccagcatcatccaggccc agcggctcggagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagccc gagcctctgtgcacccccgtagtcacctgtactcctagctgcactacctatacgtcttcc ttcgtcttcacctaccctgaggctgactccttccccagctgtgcggccgctcatcgcaag ggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system