Canis lupus dingo (dingo): 112670562 Help Entry 112670562         CDS       T08371                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism clud  Canis lupus dingo (dingo) Pathway clud01521   EGFR tyrosine kinase inhibitor resistance clud01523   Antifolate resistance clud04060   Cytokine-cytokine receptor interaction clud04061   Viral protein interaction with cytokine and cytokine receptor clud04066   HIF-1 signaling pathway clud04068   FoxO signaling pathway clud04151   PI3K-Akt signaling pathway clud04218   Cellular senescence clud04620   Toll-like receptor signaling pathway clud04621   NOD-like receptor signaling pathway clud04623   Cytosolic DNA-sensing pathway clud04625   C-type lectin receptor signaling pathway clud04630   JAK-STAT signaling pathway clud04640   Hematopoietic cell lineage clud04657   IL-17 signaling pathway clud04659   Th17 cell differentiation clud04668   TNF signaling pathway clud04672   Intestinal immune network for IgA production clud04931   Insulin resistance clud04932   Non-alcoholic fatty liver disease clud04933   AGE-RAGE signaling pathway in diabetic complications clud04936   Alcoholic liver disease clud05010   Alzheimer disease clud05020   Prion disease clud05022   Pathways of neurodegeneration - multiple diseases clud05132   Salmonella infection clud05133   Pertussis clud05134   Legionellosis clud05135   Yersinia infection clud05142   Chagas disease clud05143   African trypanosomiasis clud05144   Malaria clud05146   Amoebiasis clud05152   Tuberculosis clud05161   Hepatitis B clud05162   Measles clud05163   Human cytomegalovirus infection clud05164   Influenza A clud05166   Human T-cell leukemia virus 1 infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05168   Herpes simplex virus 1 infection clud05169   Epstein-Barr virus infection clud05171   Coronavirus disease clud05200   Pathways in cancer clud05202   Transcriptional misregulation in cancer clud05321   Inflammatory bowel disease clud05323   Rheumatoid arthritis clud05332   Graft-versus-host disease clud05410   Hypertrophic cardiomyopathy clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112670562 (IL6)    04668 TNF signaling pathway     112670562 (IL6)    04066 HIF-1 signaling pathway     112670562 (IL6)    04068 FoxO signaling pathway     112670562 (IL6)    04151 PI3K-Akt signaling pathway     112670562 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112670562 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     112670562 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     112670562 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     112670562 (IL6)    04620 Toll-like receptor signaling pathway     112670562 (IL6)    04621 NOD-like receptor signaling pathway     112670562 (IL6)    04623 Cytosolic DNA-sensing pathway     112670562 (IL6)    04625 C-type lectin receptor signaling pathway     112670562 (IL6)    04659 Th17 cell differentiation     112670562 (IL6)    04657 IL-17 signaling pathway     112670562 (IL6)    04672 Intestinal immune network for IgA production     112670562 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112670562 (IL6)    05202 Transcriptional misregulation in cancer     112670562 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112670562 (IL6)    05161 Hepatitis B     112670562 (IL6)    05171 Coronavirus disease     112670562 (IL6)    05164 Influenza A     112670562 (IL6)    05162 Measles     112670562 (IL6)    05168 Herpes simplex virus 1 infection     112670562 (IL6)    05163 Human cytomegalovirus infection     112670562 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     112670562 (IL6)    05169 Epstein-Barr virus infection     112670562 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     112670562 (IL6)    05135 Yersinia infection     112670562 (IL6)    05133 Pertussis     112670562 (IL6)    05134 Legionellosis     112670562 (IL6)    05152 Tuberculosis     112670562 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     112670562 (IL6)    05144 Malaria     112670562 (IL6)    05142 Chagas disease     112670562 (IL6)    05143 African trypanosomiasis     112670562 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     112670562 (IL6)    05321 Inflammatory bowel disease     112670562 (IL6)    05332 Graft-versus-host disease     112670562 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     112670562 (IL6)    05020 Prion disease     112670562 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     112670562 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112670562 (IL6)    05410 Hypertrophic cardiomyopathy     112670562 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112670562 (IL6)    04932 Non-alcoholic fatty liver disease     112670562 (IL6)    04931 Insulin resistance     112670562 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     112670562 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112670562 (IL6)    01523 Antifolate resistance     112670562 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112670562 (IL6) Cytokines and neuropeptides [BR:clud04052]  Cytokines   Interleukins    112670562 (IL6) SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 IL11 GCSF Sec16 Motif Other DBs NCBI-GeneID:  112670562 NCBI-ProteinID:  XP_025320128 Ensembl:  ENSCAFG00020002653 LinkDB All DBs Position 14 Genome browser AA seq 236 aa AA seqDB search MRLEMSEAHSALEPTRNERELHLPSRTPAMNSLSTSAFSLGLLLVMATAFPTPGPLAGDS KDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLE GKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKS KVKNQDEVTTPDPTTDASLQAILQSQDEWLKHTTIHLILRSLEDFLQFSLRAVRIM NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atgagactggagatgtctgaggctcattctgccctcgagcccaccaggaacgaaagagag ctccatctgccctccaggaccccagctatgaactccctctccacaagcgccttctccctg gggctgctcctggtgatggctactgctttccctaccccgggacccctggcaggagattcc aaggatgatgccacttcaaatagtctaccactcacctctgcaaacaaagtggaagaactg attaagtacatcctcggcaaaatctctgcactgagaaaggagatgtgtgacaagtttaac aagtgtgaagacagcaaagaggcactggcagaaaataacctacatcttcccaaactggag ggaaaagatggatgcttccaatctgggttcaatcaggagacctgcttgacaagaatcact accggtcttgtggagtttcagctacacctgaatatcctccagaacaactatgagggtgat aaggaaaatgtcaagtctgtgcacatgagtaccaagatcctggtccagatgctaaagagc aaggtaaagaatcaggatgaagtgaccactcctgacccaaccacagacgccagcctgcag gctatcttgcagtcgcaggatgagtggctgaagcacacaacaattcacctcatcctgcgg agtctggaggatttcctgcagttcagtctgagggctgttcggataatgtag

DBGET integrated database retrieval system