Canis lupus dingo (dingo): 112677882 Help Entry 112677882         CDS       T08371                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism clud  Canis lupus dingo (dingo) Pathway clud04010   MAPK signaling pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04024   cAMP signaling pathway clud04062   Chemokine signaling pathway clud04510   Focal adhesion clud04520   Adherens junction clud04611   Platelet activation clud04670   Leukocyte transendothelial migration clud04720   Long-term potentiation clud04722   Neurotrophin signaling pathway clud04934   Cushing syndrome clud04972   Pancreatic secretion clud05211   Renal cell carcinoma clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112677882 (RAP1B)    04014 Ras signaling pathway     112677882 (RAP1B)    04015 Rap1 signaling pathway     112677882 (RAP1B)    04024 cAMP signaling pathway     112677882 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     112677882 (RAP1B)    04520 Adherens junction     112677882 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     112677882 (RAP1B)    04670 Leukocyte transendothelial migration     112677882 (RAP1B)    04062 Chemokine signaling pathway     112677882 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     112677882 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     112677882 (RAP1B)    04722 Neurotrophin signaling pathway     112677882 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     112677882 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112677882 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     112677882 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112677882 (RAP1B)    04031 GTP-binding proteins [BR:clud04031]     112677882 (RAP1B) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112677882 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    112677882 (RAP1B)   Exosomal proteins of colorectal cancer cells    112677882 (RAP1B) GTP-binding proteins [BR:clud04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     112677882 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  112677882 NCBI-ProteinID:  XP_025332443 Ensembl:  ENSCAFG00020017012 UniProt:  A0A8C0KUP5 LinkDB All DBs Position 10:11047773..11097126 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaatggacaaggctttgcatta gtttactccatcacagcacagtctacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system