Canis lupus dingo (dingo): 112677888 Help Entry 112677888         CDS       T08371                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism clud  Canis lupus dingo (dingo) Pathway clud03050   Proteasome clud04060   Cytokine-cytokine receptor interaction clud04066   HIF-1 signaling pathway clud04217   Necroptosis clud04350   TGF-beta signaling pathway clud04380   Osteoclast differentiation clud04612   Antigen processing and presentation clud04630   JAK-STAT signaling pathway clud04650   Natural killer cell mediated cytotoxicity clud04657   IL-17 signaling pathway clud04658   Th1 and Th2 cell differentiation clud04659   Th17 cell differentiation clud04660   T cell receptor signaling pathway clud04940   Type I diabetes mellitus clud05140   Leishmaniasis clud05142   Chagas disease clud05143   African trypanosomiasis clud05144   Malaria clud05145   Toxoplasmosis clud05146   Amoebiasis clud05152   Tuberculosis clud05160   Hepatitis C clud05164   Influenza A clud05168   Herpes simplex virus 1 infection clud05200   Pathways in cancer clud05235   PD-L1 expression and PD-1 checkpoint pathway in cancer clud05321   Inflammatory bowel disease clud05322   Systemic lupus erythematosus clud05323   Rheumatoid arthritis clud05330   Allograft rejection clud05332   Graft-versus-host disease clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     112677888 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     112677888 (IFNG)    04630 JAK-STAT signaling pathway     112677888 (IFNG)    04066 HIF-1 signaling pathway     112677888 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112677888 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112677888 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     112677888 (IFNG)    04612 Antigen processing and presentation     112677888 (IFNG)    04660 T cell receptor signaling pathway     112677888 (IFNG)    04658 Th1 and Th2 cell differentiation     112677888 (IFNG)    04659 Th17 cell differentiation     112677888 (IFNG)    04657 IL-17 signaling pathway     112677888 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     112677888 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112677888 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112677888 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     112677888 (IFNG)    05164 Influenza A     112677888 (IFNG)    05168 Herpes simplex virus 1 infection     112677888 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     112677888 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     112677888 (IFNG)    05144 Malaria     112677888 (IFNG)    05145 Toxoplasmosis     112677888 (IFNG)    05140 Leishmaniasis     112677888 (IFNG)    05142 Chagas disease     112677888 (IFNG)    05143 African trypanosomiasis     112677888 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     112677888 (IFNG)    05323 Rheumatoid arthritis     112677888 (IFNG)    05321 Inflammatory bowel disease     112677888 (IFNG)    05330 Allograft rejection     112677888 (IFNG)    05332 Graft-versus-host disease     112677888 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112677888 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112677888 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:clud03051]     112677888 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112677888 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:clud00536]     112677888 (IFNG) Proteasome [BR:clud03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     112677888 (IFNG) Cytokines and neuropeptides [BR:clud04052]  Cytokines   Interferons    112677888 (IFNG) Glycosaminoglycan binding proteins [BR:clud00536]  Heparan sulfate / Heparin   Cytokines    112677888 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma TssR_C Motif Other DBs NCBI-GeneID:  112677888 NCBI-ProteinID:  XP_025332449 Ensembl:  ENSCAFG00020017024 UniProt:  A0A8C0KZT8 LinkDB All DBs Position 10:complement(10687426..10692267) Genome browser AA seq 166 aa AA seqDB search MNYTSYILAFQLCVILCSSGCNCQAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWR EESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQ IPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagctatatcttagcttttcagctttgcgtgattttgtgttcttctggc tgtaactgtcaggccatgttttttaaagaaatagaaaacctaaaggaatattttaatgca agtaatccagatgtatcggacggtgggtctcttttcgtagatattttgaagaaatggaga gaggagagtgacaaaacaatcattcagagccaaattgtctctttctacttgaaactgttt gacaactttaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg cttggcaagttcttaaatagcagcaccagtaagagggaggacttccttaagctgattcaa attcctgtgaacgatctgcaggtccagcgcaaggcgataaatgaactcatcaaagtgatg aatgatctctcaccaagatccaacctaaggaagcggaaaaggagtcagaatctgtttcga ggccgcagagcatcgaaataa

DBGET integrated database retrieval system